KEGG   Solanum pennellii: 107021472Help
Entry
107021472         CDS       T04130                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
spen  Solanum pennellii
Pathway
spen00010  Glycolysis / Gluconeogenesis
spen00562  Inositol phosphate metabolism
spen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107021472
   00562 Inositol phosphate metabolism
    107021472
Enzymes [BR:spen01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     107021472
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     107021472
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 107021472
NCBI-ProteinID: XP_015077629
Position
6
AA seq 497 aa AA seqDB search
MLKEGMNIMILLLLFLAITQFSNADEPFDVRKHLATVTRYADSKDISANSFVSSEIPDQC
TPIHLNLVARHGTRAPTKKKIRELEALDAHLEVLVRDAKEHKQYSEKIPSWLAEWRSPWK
GKVTGGELITEGEDELYHLGIRVRERFPDLFNEEYHPDVYSIKTTQVPRASASAVAFGMG
LFNERGKLGPGRHRAFAVTSESRASDIVLRFHDCCQSYKAFRKSQEPNVDKLKEPLLNEI
TRELVRQYGLNFTNQDVSSLWFLCKQEASLLNITNQACSLFSPSEVSLLEWTDDLELFIL
KGYGDTLNYRMGVPLLEDVVQSMEQAIKAKEEGYATGIYEKARMRFAHAETLLPFSCLIG
LFLEESEFERIQREESLELPPKPPKNRNWRGSNVAPFAGNNMLILYSCQSDNSSKYFVQV
LHNERPIALPGCHGSSFCPFEIFKDKIAAPHLKHDYNMLCNVIEQKQKDSASSKLSQILG
WFWSLRNAGSLARKDDL
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaggaaggtatgaatatcatgatcctgctactccttttcttagcgattacgcaa
ttctcaaacgctgatgaaccattcgacgttcggaaacaccttgccactgtaaccaggtat
gctgattcgaaggacatatctgcgaattcttttgtatcttctgaaattccagatcaatgt
acaccaattcatttgaatctggtggcaagacatggcactcgtgcaccaacaaagaagaag
ataagggaattagaagccttggatgctcatttggaagtccttgtacgtgatgcaaaagaa
cataagcaatattcggagaaaattccctcttggttagcggaatggaggtctccttggaaa
ggaaaagttacaggtggagagttgatcactgaaggagaagatgaattatatcatctcgga
atcagagtcagagaaagatttccagaccttttcaatgaagaataccacccagatgtatat
tcaatcaagactacccaggttcctcgggcatcagctagtgctgtggcatttgggatgggt
ctatttaatgaaagagggaagcttggaccaggaaggcatcgagcttttgcagttacaagc
gaaagccgtgcaagtgacatagttttgagatttcatgattgttgtcaaagctacaaggct
tttagaaaaagtcaggagccaaatgttgacaagctcaaagaacctctattgaatgaaatt
actcgtgaattagtcaggcaatatgggcttaattttacaaatcaagatgtatcttcttta
tggtttctctgcaaacaggaagcatccttattgaacatcaccaatcaagcttgtagtctg
ttcagtccatctgaggtttctttgttggagtggactgatgatttggagttgttcattctg
aaaggctatggtgacacactaaattatcgaatgggagtgccacttcttgaggatgttgtt
caatcaatggaacaggcaattaaggctaaagaagaaggatatgctacagggatctatgaa
aaagcaagaatgcgttttgctcatgcagaaactctccttcccttttcatgcctaatcggg
ctctttcttgaagaatctgagtttgaacggatacaaagagaggaaagcttggaactccct
cctaagcctccgaagaatagaaactggcggggaagtaatgtggctccttttgctggaaat
aacatgttaatcctttatagctgccaatcggacaactcaagcaagtactttgtgcaagtg
ctacataatgaacgtcccatagcattgccaggttgccatggttcgagtttttgcccattc
gaaatattcaaggataaaatagctgctcctcatttgaaacacgactacaacatgctttgc
aacgtaatagaacagaaacagaaggattctgcttccagtaagttatcacaaatacttggt
tggttttggtctttgagaaatgctggttcattggcccggaaagatgatttatag

DBGET integrated database retrieval system