KEGG   Solanum pennellii: 107023519Help
Entry
107023519         CDS       T04130                                 

Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
spen  Solanum pennellii
Pathway
spen00020  Citrate cycle (TCA cycle)
spen00640  Propanoate metabolism
spen01100  Metabolic pathways
spen01110  Biosynthesis of secondary metabolites
spen01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:spen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107023519
   00640 Propanoate metabolism
    107023519
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spen04147]
    107023519
Enzymes [BR:spen01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     107023519
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     107023519
Exosome [BR:spen04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107023519
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A Succ_CoA_lig
Motif
Other DBs
NCBI-GeneID: 107023519
NCBI-ProteinID: XP_015079719
Position
6
AA seq 421 aa AA seqDB search
MVRGMLRKLANQSLSVAGKWQQQQLRRLNIHEYQGAELMSKYGINVPKGVAVASLDEVKK
AIQDVFPNQSEVVVKSQVLAGGRGLGTFKNGFQGGVHIVKADQAEDIASKMLGQILVTKQ
TGAQGKVVSKVYLCEKMSLVNEMYFSIILDRATAGPLIIACRKGGTSIEDLAEKFPDMII
KVPIDVFKGISDADAAKVVDGLAPKVADRNDSIEQVKKLYKLFCETDCTMLEINPLAETS
DNKLVAADAKLNFDDNAAYRQKEIFSLRDSSQEDPREVAAAKADLNYIGLDGEIGCMVNG
AGLAMATMDIIKLHGGTPANFLDVGGNATEGQVVEAFKILTADEKVKAILVNIFGGIMKC
DVIASGIVNAAKQVQLKVPVIVRLEGTNVEQGKRILKESGMKLITAEDLDDAAEKAVKAL
A
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggtgagaggaatgctgcgtaaacttgccaatcagtctctttcagtcgccggaaaatgg
cagcagcaacagctccgccgcctcaacatccacgaatatcagggagctgaattgatgagc
aaatatggaatcaatgtaccgaaaggtgttgctgttgcttcccttgatgaagtgaaaaaa
gcaattcaagatgtgttccctaaccaaagcgaggttgttgttaagtcacaagtccttgct
ggtggtcgtggccttggaacgtttaaaaatggatttcagggtggagttcatattgtcaag
gctgatcaggctgaagacattgccagtaaaatgcttggacagatacttgttactaaacaa
actggagctcaaggaaaagttgtcagcaaggtttacctatgtgaaaagatgtccctggtt
aatgaaatgtacttttcaattatacttgatcgtgcaactgctggccctctcattattgct
tgtcgaaagggtggaaccagcatagaagacctagcagaaaaatttcccgacatgattata
aaggttccaattgatgttttcaaaggaatcagtgatgcagatgctgcaaaggttgttgat
ggtttggctccaaaagtagctgacagaaacgattcaattgaacaagtgaaaaagttgtat
aaacttttctgtgaaactgactgcacaatgttagagatcaacccccttgcagaaacttct
gacaacaagctggtagctgcagatgcaaagctcaattttgacgataatgctgcttaccgc
caaaaggaaatattttctcttcgcgattcatcacaagaagatcctcgtgaggttgctgct
gcaaaagctgatttgaattatattggcttggatggagaaattggttgcatggtaaatggt
gctggattggcaatggctaccatggatattattaagcttcatggggggactccagccaat
tttctagatgttggtggaaatgctactgaaggccaggttgtcgaggccttcaaaattttg
actgcagatgagaaggtgaaagctattttggtgaacatctttggcggaataatgaagtgt
gatgtgatagccagtggtattgttaatgcagccaagcaggttcaactgaaagtgcctgtg
attgttcgtctggaaggaaccaacgtcgaacaagggaagagaattctcaaggaaagtggc
atgaaactgattaccgctgaggatttagatgacgcagctgaaaaggcagtcaaggcctta
gcttag

DBGET integrated database retrieval system