KEGG   Solanum pennellii: 107024641Help
Entry
107024641         CDS       T04130                                 

Definition
(RefSeq) heat shock 70 kDa protein-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
spen  Solanum pennellii
Pathway
spen03040  Spliceosome
spen04141  Protein processing in endoplasmic reticulum
spen04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107024641
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107024641
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107024641
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:spen01009]
    107024641
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:spen03041]
    107024641
   03009 Ribosome biogenesis [BR:spen03009]
    107024641
   03110 Chaperones and folding catalysts [BR:spen03110]
    107024641
   04131 Membrane trafficking [BR:spen04131]
    107024641
   03051 Proteasome [BR:spen03051]
    107024641
   03029 Mitochondrial biogenesis [BR:spen03029]
    107024641
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spen04147]
    107024641
Protein phosphatases and associated proteins [BR:spen01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     107024641
Spliceosome [BR:spen03041]
 Complex B
  Other components
   Prp19 complex
    107024641
 Complex C
   Prp19-CDC5 complex
    107024641
Ribosome biogenesis [BR:spen03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    107024641
Chaperones and folding catalysts [BR:spen03110]
 Heat shock proteins
  HSP70 / DNAK
   107024641
Membrane trafficking [BR:spen04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    107024641
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    107024641
Proteasome [BR:spen03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    107024641
Mitochondrial biogenesis [BR:spen03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    107024641
Exosome [BR:spen04147]
 Exosomal proteins
  Proteins found in most exosomes
   107024641
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A DUF2695 AAA_23
Motif
Other DBs
NCBI-GeneID: 107024641
NCBI-ProteinID: XP_015081120
Position
7
AA seq 659 aa AA seqDB search
MSTTSSNNNSNKEGKGIGIDLGTTYSCVGVWLNDRVEIIPNDQGNRTTPSYVAFTDTERL
IGDAAKNQVAMNPHNTVFDAKRLIGRRFTDPSVQSDMKLWPFKVYSGPGDKPMIEVTYKG
EKKQFSAEEISSMVLVKMRETAESFLGFKVKNAVVTVPAYFNDSQRQATKDAGAISGMNV
LRIINEPTAAAIAYGLDKKASRKGEQNVLVFDLGGGTFDVSILTIEEGIFEVKATAGDTH
LGGEDFDNRLVNHFVTEFRRKHKKDLSGNARALRRLRTACERAKRTLSSTTQTTIEVDSL
FEGIDFYATITRARFEELCMDMFMKCMDPVEKCLRDAKVDKSQIHEVVLVGGSTRIPKVQ
QLLQDFFNGKELCKSINPDEAVAYGAAVQAAILTGEGDERVQDLLLLDVTPLSLGLETAG
GVMTTLIPRNTTIPTKKEQIFSTYSDSQPGVLIQVYEGERARTRDNNLLGKFELSGIPPA
PRGVPQINVTFDIDANGILNVTAEDKTAGVKNKITITNDKGRLSKDEIDRMVRDAERYKS
EDEEVKKKVEAKNGLENYAYNMRNTIKDEKIASKLSVEDKEKIETSVQETTEWLDKNQLA
EVDELEDKLKELEGICSPIIAKMYQGGGDGGGGPMDDDQMPGGGTTTGAGPGPKIEEVD
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgtctactactagtagtaataataatagtaataaagagggaaaagggataggaatagat
ttaggtacaacatatagttgtgttggtgtttggttaaatgatagagttgaaataatacca
aatgatcaaggaaatagaacaacaccttcttatgttgcttttactgatactgaacgtttg
attggtgatgcagctaaaaatcaagttgctatgaatccacacaatactgtgtttgatgct
aaaagattaattgggagaagatttactgatccatctgttcaaagtgatatgaaattatgg
ccttttaaggtatattcaggtccaggtgacaagcctatgattgaagtaacttacaaaggt
gaaaagaagcaattctcagctgaggagatttcatcaatggtgttagtcaaaatgagagaa
acagcagagtctttcttaggattcaaagtgaaaaacgcggtcgtaacggttccagcttac
ttcaatgattcacaaagacaagcaactaaagatgctggtgctatttcaggtatgaatgta
ttaagaatcataaatgaacctaccgccgctgctattgcttatggtttagataaaaaggct
tcaagaaaaggtgaacaaaatgtactcgttttcgatttgggaggtggaacgtttgatgtg
tcgattttgactatcgaagaagggatatttgaagttaaagcaactgcaggggatacacat
ttaggtggtgaggattttgataataggttagttaatcatttcgtaacggagtttagaagg
aaacataagaaggatttgagtgggaatgctagagcgttgaggagattgaggaccgcgtgt
gagagggctaaaaggacactatcatctacgactcaaacgactattgaagttgattcgttg
tttgaagggattgatttttatgctacgattactcgagctagattcgaagaattatgtatg
gatatgtttatgaagtgtatggaccctgttgagaagtgtttaagggatgctaaagttgat
aaatctcaaatccatgaagttgttcttgttggcggatcgactaggataccgaaagtccaa
caactattgcaggactttttcaatggtaaggagctttgcaagagtataaatccagacgag
gcagtcgcgtatggggccgcggttcaagcagctatattgactggtgaaggtgatgaaaga
gttcaagatttgcttttacttgatgttacaccattgagtcttggacttgaaactgctggt
ggtgttatgacaactttaataccacgaaacacgacgatcccaacgaagaaagaacagatt
ttttcgacctactcggatagtcaaccaggtgtactaatccaggtctatgaaggtgaaaga
gcaagaacaagagataacaatcttcttgggaaatttgaactctctggtatccctccagca
ccaagaggggttccgcaaatcaacgtcacgtttgatatagacgcgaatgggatactaaac
gtgaccgcggaggacaagacagccggggtgaagaacaagattactattacaaatgacaaa
gggagattgagtaaagatgagattgatagaatggtaagagatgctgagaggtataaatct
gaggatgaagaagtgaaaaagaaagttgaagccaaaaatggacttgagaattatgcatat
aatatgaggaatacaataaaagatgagaaaattgcaagtaaattgagtgttgaggataaa
gaaaagattgaaactagtgtgcaagagactacagagtggcttgataagaaccaattggct
gaggttgatgaacttgaagacaagttgaaggaacttgaagggatatgcagtcctataatc
gcgaaaatgtatcaaggcggtggtgatggtggtggtggtccgatggacgatgatcaaatg
cccggtggtggtaccaccaccggggctggtccgggacctaagattgaagaagttgattag

DBGET integrated database retrieval system