KEGG   Solanum pennellii: 107025655Help
Entry
107025655         CDS       T04130                                 

Definition
(RefSeq) external alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial-like
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
spen  Solanum pennellii
Brite
KEGG Orthology (KO) [BR:spen00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107025655
Enzymes [BR:spen01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     107025655
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox EF-hand_1 EF-hand_6 DAO EF-hand_5 EF-hand_7 EF-hand_8 Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 107025655
NCBI-ProteinID: XP_015081905
Position
7
AA seq 575 aa AA seqDB search
MRGFSYLKKALHIRSCSRLLVASCISSGGLLVYAENVDNNEKIVERSRLDSKKRKKIVVL
GTGWAGTSFLKDMDISSYDVEVVSPRNYFAFTPLLPSVTCGTVEARSVVEPVRNIIKKRN
GEIQFWEAECLKIDPENHQVICRSTVENLVGENDFSLDYDHLVVAVGAQVNTFDTPGVVE
YCHFLKEVEDAQKIRRTVIDCFEKAVLPGLSDEERRTNLHFVIVGGGPTGVEFAAELHDF
VHDDLVKLYPSVKDLVKITVIQSGDHILNTFDERISCFAETKFQRDGIEVLTGCRVVSVS
EHSVNMKVKSTGEYVVVPHGMVVWSTGVGTRPFVRNFMEEIGQGKRWILATDEWLRVKDC
PDVYAIGDCTTVDQRKIMEDISTIFEAADTDRSGTLTIKEFQDVLEDIIIRYPQVELYLK
SNHLFQVTELFKDSEGNEREEVDIEGFKLALSHVDSQMKSLPATAQVAAQQGSYLAGCFN
RWEQCNANPEGPRLFGSAGRHAFRPFTYRHLGQFAPLGGSKAAAELPGDWVSMGRSTQWL
WYSVYASKQVSWRTRILVVWDWTRRYIFGRDSSRI
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgaggggtttctcatatttgaaaaaagctcttcatatccgttcttgttccaggcttttg
gttgcttcttgtatcagtagcgggggtctcttggtatatgcagaaaatgtagacaacaat
gaaaaaattgttgaaaggagtcgattggattcaaaaaagaggaagaaaatagtggtgctt
ggaacaggatgggctggcaccagtttcctaaaggatatggatatttcttcctatgatgtc
gaagtggtgtctccgcgtaactactttgcatttactcctttgttacctagtgtcacttgt
ggaactgttgaggcacgaagcgttgtagagccagtcaggaacataataaagaagagaaat
ggagaaattcaattttgggaagcggaatgtctcaagattgatcctgaaaaccatcaagtc
atttgccgttctactgtcgaaaatttggttggagagaacgatttttcgctagactatgac
catttggttgtagcagtaggagctcaagtgaacacttttgacactcctggtgttgtggaa
tattgtcactttctgaaggaagttgaagacgctcagaagatacgaaggacagtaatagat
tgttttgaaaaagctgtcctcccgggcttaagtgatgaagagagaaggaccaatctccat
ttcgttatagttggagggggtccaaccggagtggaatttgcagctgagctacatgacttt
gttcatgatgatttggtaaaattatacccttcagttaaggatttagtgaagataaccgtc
atccaatctggagatcatatcctgaacacgtttgacgagagaattagctgttttgctgaa
actaagtttcaaagagatggaattgaggttttgacaggttgccgtgttgttagtgtttct
gaacattcagttaacatgaaagtaaaatctacaggagaatatgtcgttgtgccccatgga
atggttgtgtggtctactggagtcggtactcgcccatttgtgaggaatttcatggaagaa
attggccaggggaagagatggatcctagcaactgatgaatggttacgagtaaaggattgt
cccgatgtgtatgctattggtgattgtaccactgtcgatcaacgtaaaattatggaagat
atttcaaccatttttgaagcagcggatacggatcgttctggaaccttaactatcaaagaa
ttccaagatgttctggaagacataatcatccgatatcctcaagtggagctgtacctaaag
agcaaccatttgtttcaagtaacggagttattcaaggattcagaaggaaatgagagagag
gaggtagatattgaaggatttaagttagccctttctcatgtcgattcccaaatgaagagt
ctacctgctactgctcaggttgctgctcaacaaggttcatatcttgctggctgctttaac
cgttgggaacaatgcaacgctaaccctgaaggtcctcgcctatttggaagtgcagggcgt
catgcatttcgacccttcacatatcggcatttagggcaatttgcaccattaggtgggagc
aaagcagcagcagagcttcctggagactgggtatcaatgggtcgtagcacacaatggctt
tggtactctgtttatgcaagcaagcaagttagctggcgtacaaggatcttagttgtatgg
gattggacaagaagatatatttttggaagagattcaagtcgaatatga

DBGET integrated database retrieval system