KEGG   Solanum pennellii: 107027057Help
Entry
107027057         CDS       T04130                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit C-like
  KO
K03252  translation initiation factor 3 subunit C
Organism
spen  Solanum pennellii
Pathway
spen03013  RNA transport
Brite
KEGG Orthology (KO) [BR:spen00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    107027057
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:spen03012]
    107027057
Translation factors [BR:spen03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    107027057
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI Curto_V2 DUF1722
Motif
Other DBs
NCBI-GeneID: 107027057
NCBI-ProteinID: XP_015083710
Position
1
AA seq 918 aa AA seqDB search
MASRFWTQGDSDTEEEEESDYELEDDAPAENPDAPSGPGSRYLAADDSDSDESDGQKRVV
RSAKDKRFEELSATVDQMKNAMKINDWVSLQESFDKINKQLEKVMRITESIKPPNLYIKA
LVMLEDFLNQALANKETRKKMSSSNAKALNSMKQKLKKNNKQYEELINKYRENPPVSEEE
GGDDEESEEEEEEDEEEFEEDPTKIASASASDDDDPDTIGDGWEKKVNKKDKLLDKQFKD
PSQITWEIVNKKFKEIVAARGRKGTGKMELVEQLTFLTKVAKTPAQKLEILFGVVSAQFD
INPGLSGHMPINVWKRCVQNMLTILDVLTQYPNIVVDDMVEPDENETQKGADHSGTIRIW
GNLVAFVERIDVEFFKSLQVIDPHTSQYVERLRDEPLFLVLAQNVQRYLEQMGDYKGAAK
VALKQVEFIYYKPQGVYDAMRKLAELTEGGEAESVDENKVVEESKGPTAFIATPELVPRK
PAFEENSRTLMDSLVSLIYKYGDERTKARAMLCDIYHHAILDEFSTSRDLLLMSHLQENI
QHMDISTQILFNRAMAQLGLCAFRMSFVAEAHGCLAELYSAGRVKELLAQGVSQSRYHEK
TPEQERMERRRQMPYHMHINLELLEAVHLTCAMLLEVPNMAANSHDMKRRVISKTFRRLL
EISERQTFTGPPENVRDHVMAATRSLRQGDFQKAFDVINSLDVWRLLRNKDSVLEMLRGK
IKEEALRTYLFTYSASYNSLSLDQVAGMFDLSVSQIHSIVSKMMISEELHASWDQPSRCM
VFHDVEHTRLQALAFQLTEKLSVLAESNERATESRIGGGALEGLPPRRRDGQDYAAAAGG
GGRWQDFSFSQGRQGSSGGRTGYAGGRSTSGQTSRDRTNQARGTLGGQGSRYQSGTISRG
SQMDGSGRMVNLNRGGRS
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcccgtttttggactcagggtgatagtgataccgaagaggaggaggagagtgat
tacgagctggaagatgatgcgccagctgaaaatccagatgcaccgtctgggcctgggtca
agatatcttgcagctgatgatagcgatagtgatgaatcggatggacagaagcgagttgtc
cggtcagccaaggacaagcgttttgaggagttgtcagctacagttgatcagatgaagaat
gctatgaagattaatgactgggttagcttgcaggagagctttgacaagattaataagcag
ctggagaaggtcatgcgcattacagaatctattaaaccaccaaatctctatatcaaagct
ctagtgatgctggaggatttcttgaatcaggccttggccaataaggagactaggaagaag
atgagtagtagtaatgctaaagccttgaattcaatgaaacagaaactgaaaaagaataat
aagcagtacgaggagttgattaataagtatagggaaaatcctcctgtgagcgaggaggag
ggtggtgatgatgaagagtcggaagaggaagaagaagaggacgaagaggagtttgaggag
gacccaacaaagattgcatctgcatctgcatctgatgatgatgatccggacacgataggt
gatgggtgggagaagaaggtgaacaagaaagacaaacttctggataaacagtttaaagat
ccgagtcaaatcacgtgggagatagtcaacaagaagttcaaggaaatcgttgctgctagg
ggtagaaaggggactggaaagatggaattggtcgaacagctcaccttcttgaccaaggtg
gccaagactccagcacagaagcttgaaattctgtttggtgttgtgtctgcccagtttgat
atcaatccaggtctcagtggacacatgcctataaatgtgtggaaaaggtgtgtgcaaaat
atgcttacaatccttgatgttttgacccaatacccaaacattgtggttgatgatatggtg
gagcctgatgagaatgagacccagaaaggagcagaccactcagggactataaggatctgg
ggaaatttggttgcctttgttgaaaggattgatgtagagtttttcaagagcttgcaggta
attgatccacataccagccagtatgttgagaggctgagagatgagccattgtttttggtt
cttgctcaaaatgtccagcgttatttagaacagatgggcgactataagggcgctgccaaa
gtggctcttaaacaggttgaattcatctattataagccgcaaggagtgtatgatgctatg
aggaagttggctgagctcacagaaggtggagaggcagagtctgtagatgaaaacaaagtg
gttgaggagagtaaaggtccaactgcatttattgcaactcctgagcttgtgcctaggaaa
cctgcttttgaagagaacagcaggacattgatggacagtctcgtttctctcatatataaa
tatggagatgaacgaaccaaggcccgtgcaatgctctgtgatatatatcaccatgctatc
ttggatgagttttcaacatcccgtgacttgttattgatgagtcacttgcaggaaaatatc
cagcacatggacatttcaactcagatactttttaacagagccatggctcaacttgggctc
tgtgcgttcaggatgtcatttgttgcagaagcgcatggttgccttgctgaactctattct
gctggcagggtgaaagagttactggcgcaaggtgtctcccaaagccgatatcatgagaag
actccagaacaggagcggatggagaggaggcgtcagatgccctaccatatgcatataaat
cttgagcttcttgaggctgtccatctgacatgtgcaatgcttcttgaagtgccaaacatg
gcagctaatagccatgacatgaagcgcagggtcataagcaaaacattccggagattgctt
gaaatcagtgagaggcaaactttcactggtccacctgaaaatgtgagggaccatgtcatg
gcagcgacaaggtccctgaggcaaggagactttcagaaggcttttgatgtcatcaactcc
cttgatgtgtggaggctgcttcgcaacaaggacagtgttctggagatgcttagaggcaaa
atcaaggaagaggcactgaggacctaccttttcacatattctgcttcttataattctctg
agtttggatcaggttgctgggatgtttgacctttcagtttctcagatccatagcattgtg
agcaaaatgatgatttctgaggagcttcatgcaagctgggatcaaccatcccgatgcatg
gtctttcatgatgttgagcatacaagattgcaggctttggcattccagttgacagaaaag
ctgtcagttttagcagaaagtaatgaaagagcaacagaatcgaggattggtggtggtgca
ttggagggccttccaccaaggcgcagggatggccaggattatgctgctgcagctggtggt
ggtggtagatggcaggacttctccttctcacaaggcaggcaaggtagtagtggtggccga
acagggtatgccggtggtagatcaacttctggtcaaacgtcgagggaccgtactaatcag
gcacgagggactcttgggggtcaaggctcaagatatcagagtggtacaatttccagggga
agccagatggatggatcaggtcgcatggttaatcttaacagagggggtcgttcttag

DBGET integrated database retrieval system