KEGG   Solanum pennellii: 107027074Help
Entry
107027074         CDS       T04130                                 

Definition
(RefSeq) tyramine N-feruloyltransferase 4/11-like
  KO
K22246  tyramine N-feruloyltransferase [EC:2.3.1.110]
Organism
spen  Solanum pennellii
Brite
KEGG Orthology (KO) [BR:spen00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107027074
Enzymes [BR:spen01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.110  tyramine N-feruloyltransferase
     107027074
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_1
Motif
Other DBs
NCBI-GeneID: 107027074
NCBI-ProteinID: XP_015083728
Position
8
AA seq 240 aa AA seqDB search
MAPALQQAITTDASSDVTITGKIYTRVRLATKSDLSHIYKLFYQIHEYHNYTHLYKATES
SLAKLLFKENPLPLFYGPSVLLLEVSPTPFDEPKNTTDEGFKPVLTTFDLKFPVVEGQVE
EFRSKYDDKSDAYIAGYAFFYANYSCFNDKPGFYFESLYFRESYRKLGMGKLLFGTVSSI
AADNGFVSVDGIVAVWNKKSYDFYINMGVEIFDEFRYGKLHGENLQKYAHNKGEIEEETC
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggctcctgctcttcaacaagctataaccaccgatgcatcatcggacgttaccatcact
ggaaagatatacacacgagttcgtctcgctacgaaatctgatctttctcatatatacaaa
ttgttttaccaaatccatgaataccataactatactcatttatacaaagctaccgagtcc
tccttagccaaattgctctttaaagaaaatcctcttcctcttttctacggtccatccgta
cttctacttgaagtctctccaacaccttttgacgaacctaaaaatactacagacgaaggg
ttcaagcctgtccttacaacgtttgaccttaaattcccagtcgtagaaggacaagttgag
gaattccgatccaaatatgatgataagagtgatgcttacatcgcgggatatgctttcttt
tacgcgaattattcatgtttcaatgataagcctggattctattttgagagtctttacttc
agagagagttatagaaagttgggaatggggaagttgttgtttggaacagtttcgtccatt
gctgcggacaatgggttcgtatcggtcgatggaatagtagcagtttggaataagaagtca
tatgatttttacataaatatgggagttgaaatatttgatgaatttagatatgggaagttg
catggtgaaaatcttcaaaagtatgcacataacaagggggaaattgaggaagagacctgt
tag

DBGET integrated database retrieval system