KEGG   Solanum pennellii: 107028569Help
Entry
107028569         CDS       T04130                                 

Definition
(RefSeq) peroxisomal acyl-coenzyme A oxidase 1-like
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
spen  Solanum pennellii
Pathway
spen00071  Fatty acid degradation
spen00410  beta-Alanine metabolism
spen00592  alpha-Linolenic acid metabolism
spen00640  Propanoate metabolism
spen01040  Biosynthesis of unsaturated fatty acids
spen01100  Metabolic pathways
spen01110  Biosynthesis of secondary metabolites
spen01200  Carbon metabolism
spen01212  Fatty acid metabolism
spen04146  Peroxisome
Module
spen_M00087  beta-Oxidation
spen_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:spen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    107028569
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107028569
   00592 alpha-Linolenic acid metabolism
    107028569
   01040 Biosynthesis of unsaturated fatty acids
    107028569
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107028569
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107028569
Enzymes [BR:spen01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     107028569
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 107028569
NCBI-ProteinID: XP_015085164
Position
8
AA seq 664 aa AA seqDB search
MEGVDYLADERKKAGFDVDEMKIVWAGSRHDFELTDRISKLVANDPGFSKEGRTMLPRKE
LFKNTLRKAAYAWKRIIELRLSQEEATMLRRYVDEPAFTDLHWGMFIPAIKGQGTDKQQE
KWLPLAYKMQIIGCYAQTELGHGSNVQGLETTATFDPQTDEFVIHSPTLTSSKWWPGGLG
KVSTHAVVYARLITDGKDYGVNGFIVQLRSLEDHKPLPGVTVGDIGMKFGNGAYNSMDNG
VLSFDHVRIPRDQMLMRVSQVTKEGKYVQSDIPRQLLYGTMVYVRQSIVADASLAMSRAV
CIATRYSAVRRQFGSQNGGQETQVIDYKTQQNRLFPLLASAYAFRFVGEWLKWLYTDVTQ
RLAANDFSTLPEAHACTAGLKSLTTTATADGIEECRKLCGGHGYLCSSGLPELFAVYVPA
CTYEGDNVVLQLQVARFLMKTISQLGTGKKPVGTVSYMGRIEHLMQCRSDVKQAEDWLKP
SAVLEAFEARSARMSVACAKNLSKFENQEEGFAELAADLVEAAVAHCQLIVVSKYIEKLQ
QNIPGKGVKQQLEVLCGIYSLFLLHKHQGDFLGTGYITSKQGSLANDQLRALYSQLRPNA
VSLVDAFNYTDHYLGSILGRYDGNVYPKLYEAAWKDPLNNSDIADGFHEYIRPLLKQQLR
TAKL
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atggagggtgtagattatttggctgatgagaggaagaaagctggatttgatgtggatgag
atgaagattgtttgggctggttctcgtcatgattttgaacttacagatcgtatctctaag
cttgttgctaatgatcctggcttcagtaaggagggaagaaccatgcttcctaggaaagag
ctattcaagaacactctaaggaaggcagcatatgcatggaaacggatcattgaacttcgt
ttatctcaagaggaagcgactatgttaaggcgttatgtagatgagcctgcttttactgat
cttcattggggaatgtttatacctgccataaaaggacagggcacagataaacagcaggaa
aagtggctgccgttggcttacaagatgcaaataattggctgttatgctcaaactgaactt
ggtcatgggtccaatgtgcaaggccttgagaccactgccacatttgatcctcaaacagat
gaatttgttattcatagtccaacattgacatcaagcaagtggtggcctggtggattgggt
aaagtgtctacccatgctgttgtgtatgctcgtcttataacagatggtaaagactatggg
gttaatggttttattgtccaactacggagcttggaggaccacaaacctcttccaggtgtt
actgttggagacattggaatgaaatttgggaacggagcatacaattccatggataatggg
gtgttaagctttgatcacgtgcgcattccaagagatcaaatgttgatgagggtttcacaa
gttacaaaggaaggaaaatatgttcagtctgatattcctcgacaactcctttatgggacc
atggtatatgtacggcaatcaattgtagcagatgcttcccttgcaatgtctcgggctgtg
tgtattgcaaccagatacagtgccgttcgtagacaatttggctctcagaatggtggacaa
gaaactcaggtgattgactacaaaactcagcaaaacaggctcttccccttgttggcttct
gcatatgccttcagatttgttggtgagtggctgaaatggttgtacactgatgttacccaa
agacttgcagcaaatgatttctcaacattgcctgaggcacatgcatgtaccgcaggattg
aagtctttgaccaccactgccactgctgatggaattgaagaatgccgaaagttatgtgga
ggtcatggttatctttgtagcagtgggcttccagaattatttgccgtttatgtccctgcc
tgtacttacgaaggagataatgtcgtgctacagctacaggttgcaaggtttcttatgaag
accatttcacaactgggcactggaaagaagccagtaggtaccgtatcttatatgggaaga
atcgaacacttgatgcagtgtcgttctgatgtgaaacaagccgaggactggctgaaacct
agtgcagtattggaagcatttgaagcaaggtctgccaggatgtctgttgcctgcgctaag
aatcttagcaagtttgagaatcaagaagaaggctttgcagaactagcagctgatttagtt
gaagcagcagttgctcattgtcaattaattgttgtgtccaagtatatcgagaagttgcaa
caaaacattcccggtaaaggggttaagcaacagctggaggtgctttgtggcatctattca
ctgttccttcttcacaaacatcaaggagattttctcgggactggctacatcacctcaaag
caggggtcgcttgctaacgaccagctcagagccttgtattcccagcttcgtccaaatgct
gtatcactggttgatgcatttaactataccgatcactaccttggttcaattcttggacgt
tatgatggaaacgtgtatccaaaactgtatgaggctgcatggaaggatcctctcaacaat
tcagacatagcagatggcttccacgaatatattaggccactactcaagcagcaactacga
actgctaagctgtga

DBGET integrated database retrieval system