KEGG   Solanum pennellii: 107028842Help
Entry
107028842         CDS       T04130                                 

Definition
(RefSeq) N6-adenosine-methyltransferase MT-A70-like
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
spen  Solanum pennellii
Brite
KEGG Orthology (KO) [BR:spen00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:spen03019]
    107028842
Enzymes [BR:spen01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     107028842
Messenger RNA biogenesis [BR:spen03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     107028842
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70 Macro
Motif
Other DBs
NCBI-GeneID: 107028842
NCBI-ProteinID: XP_015085547
Position
8
AA seq 738 aa AA seqDB search
METHADGTDEIAAVEELRQQHETRIQTLHNAQLELIASLQNIVPDIVSSLDLSLKTISSF
NGKPFTPLPSPLPNAPNHNPNLLVPKINSSSGKRVSELSRSGSEKEKMVIDECGGPLSVV
RAMVAVCLLERVPFTAIDSSTLLRKLENDQSHTAAEKAAIRELGGESGAIVAVEMALKSM
AEDNGCVELENFVVSGKSRIMVLNIDRTRLLKELPESKQNEGSVGGGNRNNQEIIKRGID
NGGAFGMGRGMSEMWEHPHMQGMTAMFPGNMGGPRGGHRGMVGMMGMPRGVGVPPPMHRP
PMGPNGQIGGGGNSIALKPRSEEDELKDLEKMLNKKSFKEMQKSKTGEELLDLIHRPTAK
ESAVAAKFKSKGGSQVKEYCSALTKEDCRRQAGSYIACDKVHFRRIIAVHTDVNLGDCSF
LDTCRHMKTCKYVHYELDSTPDVSPLMMGASTLAPPKPLKPQRAHYCSEVELGEPQWINC
DIRSFRMDILGQFGVIMADPPWDIHMELPYGTMADDEMRTLNVPALQTDGLIFLWVTGRA
MELGRECLELWGYKRVEEIIWVKTNQLQRIIRTGRTGHWLNHSKEHCLVGIKGNPEVNRN
IDTDVIVAEVRETSRKPDEMYPLLERISPRTRKLELFARMHNVHGGWMSLGNQLQGVRLV
DEGLRARFKAAYPDVEVQPASPPRPSAMEVDSSSNQIRNTFAGGELKAAGTQVTEATPPD
AAAYATEGKPVNRDCGDD
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atggaaactcatgctgacggcacagatgaaattgccgccgtggaggagctacggcaacag
cacgaaacccgtatacaaaccctacacaacgctcaattggaactcatcgcctcactgcaa
aacatagttcctgatatagtctcttcactcgacctctctcttaagaccatttcatccttc
aatggaaaacccttcacccctttacccagcccactccctaatgcccccaaccataaccct
aatttactcgtcccaaagatcaattcctcttctggtaaacgtgtttcagaactttctaga
agtggtagtgagaaggagaaaatggtaattgatgaatgtggaggacctttgtcggttgta
agggcgatggttgcagtttgtttgttagagagagtgccgtttactgctattgattcgtct
actttgttaaggaagttagagaatgatcagtcgcatacggctgctgaaaaggcagcgatt
agggagctcggaggggagtcgggggcgatagtagcagtggaaatggcattgaaatcgatg
gcggaggataatggttgtgtagaattggagaattttgtggttagcgggaaatctaggatt
atggtgttgaatattgatagaactaggctattgaaagaattgccggaaagtaagcagaat
gagggaagtgttggtggaggaaaccggaataatcaggaaataataaaaagagggattgat
aatggaggtgcttttggaatgggaaggggaatgagtgaaatgtgggagcatccacatatg
caggggatgacagctatgtttcccgggaatatgggcggtccaagaggagggcatagagga
atggtgggtatgatggggatgccgagaggtgttggtgttccacctcctatgcatagacca
ccaatgggaccaaatgggcaaataggaggaggagggaattctattgctttaaaacctagg
tcagaagaagatgagttgaaggatttagagaaaatgttgaataagaaaagttttaaggaa
atgcagaaatcgaaaaccggagaggagttattggaccttattcatcgtcccactgcaaag
gaatctgccgtcgctgcaaagttcaaaagcaaaggtggttcccaggtgaaggaatattgt
tcagctttaacaaaggaagattgtcgacgccaagctggttcctacattgcttgtgataag
gttcattttcggcgaataattgctgtgcatactgatgtcaacttgggtgattgctctttt
cttgatacttgccgtcacatgaagacatgcaagtatgtacattatgagcttgactcgacg
ccagatgtatcacccctgatgatgggagcatctaccttggcccctcccaagcctttgaaa
ccacagcgtgctcattactgttcagaagtagagcttggtgaaccacaatggattaattgt
gacatacggtcatttagaatggatattttagggcagtttggagttataatggctgatcca
ccatgggatattcatatggaattgccttatgggacaatggctgatgatgaaatgcgcact
ttaaatgtcccggcactgcaaactgatggtcttatattcctttgggtcaccggacgcgca
atggagcttggacgggaatgtctagagctttggggttacaagcgtgttgaggagattatt
tgggttaagaccaatcaacttcagcgaatcatcagaactggacggacaggccattggctc
aatcacagcaaggaacattgccttgttggaataaagggaaatccagaggtgaacaggaat
attgatactgatgtcatagtagcagaggttcgggaaacaagtcgtaagccagatgagatg
taccccttgctcgaaagaattagtccaaggacaagaaagctggagttatttgctcggatg
cacaatgttcatggcgggtggatgtcacttggaaaccaactacaaggggtacgattggtt
gatgaaggacttagggcgcggttcaaggctgcatatccagatgtggaggtgcaacctgca
tcacctcctaggccatctgctatggaagtagattcaagttctaatcaaataaggaataca
tttgctggaggtgaattaaaggctgcagggacacaggtcactgaggctacacctccagat
gcagcagcctatgcaactgaaggaaaaccagtaaaccgtgattgtggagatgactag

DBGET integrated database retrieval system