KEGG   Solanum pennellii: 107029051Help
Entry
107029051         CDS       T04130                                 

Definition
(RefSeq) probable carotenoid cleavage dioxygenase 4, chloroplastic
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
spen  Solanum pennellii
Pathway
spen00906  Carotenoid biosynthesis
spen01100  Metabolic pathways
spen01110  Biosynthesis of secondary metabolites
Module
spen_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:spen00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    107029051
Enzymes [BR:spen01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     107029051
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 107029051
NCBI-ProteinID: XP_015085832
Position
8
AA seq 592 aa AA seqDB search
MDALSSTFLSTLSQKPKSLLSPYNNNNYHYYSPTLKVFSVRIEERPQTTTTIAKPQEKST
PSPPKPSPKREPIPSRKPIEPSFPSFIFNAFDDFVNTFIDPPRKSSVDPRYVLSNNFAPV
DELPPTECEVVEGSLPSCLDGAYIRNGPNPQYLPRGPYHLFDGDGMLHSIKISQGKATLC
SRFVKTYKYNIENEAGSPIIPNVFSGFNGLTASAARGALTAARAIAGQFNPANGIGLANT
SLALFGGKLFALGESDLPYEVKIAPNGDIFTLGRHDFNGKLFMSMTAHPKIDPETNEAFA
FRYGPMPPFITYFRVNPDGTKTQDVPIFSMTRPSFLHDFAITKKYAIFSDIQIGMNPIDL
LTGGSPVGTDSGKIPRIGVIPRYAIDESEMRWFDVPGFNIVHAINAWDEDGGDTIVLIAP
NILSVEHTLERMDMIHASVEKVKINLKTGMVSRHPISTRNLDFGVINPAYVGKKNKYVYA
AIGDPLPKVIGIAKLDVSIAEIDRRDCIVACRIFGEDCYGGEPFFVPENPSIDEDDGYVV
SYVHNEKTGESNFLVMDATSPNLDIVANVKLPRRVPYGFHGLFVSENDLMKL
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggatgctttgtcttcaactttcctttctacattatcacaaaaacctaaatctcttctt
tctccttataataataataattatcattactattctcctactctgaaagtattttctgtt
agaattgaagaaagaccacaaacaaccactactatagcaaaaccacaagaaaaatcaacc
ccttcaccaccaaaaccatctccaaaaagagaaccaataccctcaagaaaacctattgaa
ccatcatttccctcttttatcttcaatgcattcgatgatttcgtaaatactttcattgat
ccacctaggaaatcgtctgttgatccaaggtatgttctctctaacaacttcgctccagta
gacgaacttcctcctactgaatgcgaagtagtggaaggctctcttccctcttgcctagac
ggcgcgtatattagaaatggaccgaaccctcaatatcttccacgtggaccttaccatctt
ttcgacggtgatggaatgcttcactctattaaaatttcccaaggtaaagctacgttatgt
agtcgatttgtcaaaacttacaagtacaatatcgaaaatgaagccgggtcacccattatt
cctaatgtgttctccggtttcaacggtcttaccgcctcggccgcgcgtggtgcactcacc
gcggcccgggctattgcgggacagttcaatcccgcaaacggtataggccttgcgaataca
agcttagctttatttggaggtaaacttttcgccctcggtgaatctgatttaccatatgag
gtaaaaatagccccaaatggtgacatttttaccctcggccgtcacgattttaacggaaaa
ctttttatgagcatgacggcacatccgaaaatcgaccccgaaactaacgaggcttttgct
ttccgttacggcccgatgcctccgtttataacttactttcgggtcaacccggatggtaca
aaaacccaggatgtacccatattctcaatgacccgcccgtcatttcttcatgactttgca
atcacaaaaaaatacgcgatattttcggacatacaaattggaatgaatccaattgattta
ctcaccggtggttcaccggtgggtactgactcggggaaaattccccgaattggtgtgata
ccacgttacgccatagatgagtcggaaatgaggtggtttgatgtaccaggatttaatatt
gtacacgcaatcaacgcgtgggatgaggatggaggtgatacgatagtgttgatcgcgccg
aatatattatcggtggaacatacactagagaggatggacatgatacatgcaagtgttgag
aaagtgaaaataaatttgaagacaggaatggtgagcagacatccaatttctacaagaaat
cttgattttggagtcatcaatccagcttatgttgggaaaaagaacaagtacgtatatgca
gccattggggatcctttgccaaaagtaatagggatagcaaaattagacgtatccatagca
gaaattgatcgtcgcgattgcatcgtggcatgtcgtatatttggagaagattgctatggt
ggtgaaccatttttcgtgcctgaaaatccttcgatcgatgaagatgatggctacgtggtg
tcatacgtacacaatgagaagacaggggaatcaaattttttggtcatggatgcaacatca
cctaatcttgacattgtggctaatgtcaaattgcctcgtcgtgtgccttatggtttccat
ggacttttcgtgagtgaaaatgatcttatgaagctataa

DBGET integrated database retrieval system