KEGG   Solanum pennellii: 107031601
Entry
107031601         CDS       T04130                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
spen  Solanum pennellii
Pathway
spen00100  Steroid biosynthesis
spen01100  Metabolic pathways
spen01110  Biosynthesis of secondary metabolites
Module
spen_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:spen00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    107031601
Enzymes [BR:spen01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     107031601
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 107031601
NCBI-ProteinID: XP_015088513
Position
9
AA seq 369 aa
MDLNNLFISLTPSWTSVSMLIGFFLYLATVGSILPGKLVPGATLSDGTRLHYRCNGLLSL
LLLVLLLGVGSQMNLVSPTAIADRGLELLSTTLIFSVLVTLMLYLVGLNSRAKSSSLKPH
VSGNLIHDWWFGIQLNPEFMGIDLKFFFVRAGMMGWLLINLSVLAKCVIEAKLSQSMILY
QLFCGLYILDYFFYEEFMTSTWDIIAERLGYMLVFGDLVFIPFTFSIQGWWLLSNEVELT
TAAIIANCLVFLIGYSVFRGANKQKHVFKKDPKAPIWGSPPKVIGGKLLASGYWGIARHC
NYLGDLLLASSFSLPCGISSVVPYFYPIYLLILLIWRERRDEARCAEKYKDVWAEYRKLV
PYRILPYVY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggatctcaataatctcttcatttctctcactccatcatggacttcggtgtctatgttg
atcggattttttctctatttagctaccgttggatctattctaccaggaaaacttgttcct
ggggcgactttgtctgatggaactcgactccattatcgttgcaatggtttattatccctt
ctgttgttggttttgcttcttggagttgggtcgcagatgaatcttgtttcacctactgct
atagcagatagaggacttgagcttttgtccacaacacttatctttagtgttcttgtgaca
ttgatgctttatttggttggcctgaactcacgtgcaaagagttcatcactgaaacctcat
gtctcaggaaatctaatccatgactggtggtttgggatacaactgaatcctgaattcatg
ggcattgatctcaaatttttctttgttagagctggtatgatgggatggttacttatcaat
ctttcagttcttgcaaaatgtgttatagaggctaaattgagccaatcaatgattctctac
cagctattttgtgggctctacatccttgactacttcttctatgaagagttcatgacctcc
acatgggatataatagcagagaggttgggctacatgctggtttttggtgatctagtcttt
ataccgttcaccttcagtattcagggttggtggcttttgagtaacgaagtggagctaaca
acagcagcaataattgccaattgcctcgtctttcttattgggtattcggtgttcagagga
gccaataagcagaagcatgtatttaaaaaggatcccaaggcacccatatggggtagtcct
ccaaaagttattggggggaagttacttgcttctggctattggggcattgcacggcactgt
aattacctcggggacttgttgctggcatcatcttttagtttaccttgtggtataagctct
gtggttccatacttttaccccatatatcttctcattctactcatatggagggagagaagg
gacgaagctagatgtgcagagaagtacaaagatgtgtgggctgaataccgtaaacttgtt
ccttacaggatcttaccttacgtttactag

DBGET integrated database retrieval system