KEGG   Solanum pennellii: 107032067Help
Entry
107032067         CDS       T04130                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 1-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
spen  Solanum pennellii
Pathway
spen00052  Galactose metabolism
spen00500  Starch and sucrose metabolism
spen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107032067
   00500 Starch and sucrose metabolism
    107032067
Enzymes [BR:spen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     107032067
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 107032067
NCBI-ProteinID: XP_015089117
Position
10
AA seq 582 aa AA seqDB search
MEILRKSSSLWALPILVLCFFINNGVFVDASHKVYMHLQSTTSHVDASKVHRTGYHFQPP
KNWINDPNGPMYYNGVYHLFYQYNPKGAIWGNIVWAHSVSKDLINWIPLEPAIYPSKVFD
KYGTWSGSATILPGNKPVILYTGIVDANKTQVQNYAIPANMSDPYLRKWIKPDNNPLIVA
DKNINKIQFRDPTTAWMGRDGYWRILVGSVRNHRGKVIMYKSNKNFMKWTKAKHPLHSAQ
GTGNWECPDFFPVSLKNKNGLDTSYNGKDAKHVLKVSFDVTRFDHYTVGTYDTKKDKYFP
DNTSIDGWKGLRLDYGNYYASKTFFDSGKNRRILLGWANESDTVDNDVKKGWAGVHPIPR
KIWLDPSGKQLVQWPVQELETLRKKKVQLYNKKLNKGEKVEIKGITVAQADVEVIFSFAS
LDKAEPFDSSWGDLYAQDVCAIKGSTVQGGLGPFGLLTLASKNLEEYTPVFFRVFKAHDK
YKVLMCSDASRSSLKNETTMYKPSFAGYVDVDLADKKLSLRSLIDNSIVESFGAEGKTCI
TSRVYPTLAIFDKAHLFAFNNGAETITIETLNAWSMANAKLH
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atggagattttaagaaaatcttcttctctttgggctttgccaattcttgtgttgtgtttc
tttatcaacaatggagtatttgttgatgcttctcacaaagtttatatgcacttgcaatct
actactagtcatgttgatgctagcaaggttcatagaactggttatcattttcaacctcct
aaaaattggattaacgatccaaatggtccaatgtattacaacggagtgtaccatctattt
taccagtacaacccaaaaggagcaatatggggcaacattgtttgggctcattcagtctca
aaggacttgatcaattggatcccactcgaacccgctatctacccgtctaaagtatttgac
aagtacggtacatggtccgggtcagccacaattttaccaggcaacaagcctgtgatcctc
tacactggaattgtggatgctaataaaacacaagtccaaaactatgcaatcccagctaac
atgtctgatccatatcttcgtaagtggatcaagcccgataacaatccattgattgtcgcg
gataaaaacataaataaaatccaatttcgcgatccaacaacagcttggatgggcagagat
ggatactggagaattttggttgggagtgtgaggaatcacaggggaaaagttataatgtac
aaaagtaataagaacttcatgaaatggaccaaagctaaacacccactccactcagctcag
ggtactggaaattgggaatgtcctgatttttttccagtgtcgttgaaaaataaaaatggt
ttggacacgtcgtacaatggaaaagatgctaaacatgttcttaaagttagcttcgatgtt
acgaggtttgatcactatacagttggtacgtacgacaccaaaaaggataagtactttccg
gataacacttctattgatggatggaaaggattgagacttgattatggtaattattacgcg
tccaagacgttctttgatagtggcaagaatcgtaggattttattgggttgggctaatgaa
tcagatacggttgataacgatgtgaaaaagggatgggccggggttcaccctattcctcgt
aaaatatggcttgatcctagtggaaaacaattggttcaatggcctgttcaagaattagaa
actctaagaaagaaaaaggtccaattatataacaaaaaattgaacaagggagaaaaggtt
gaaatcaaaggaatcacagttgcacaggctgatgttgaagtgatattctcattcgcgagt
ttggacaaggcagagccatttgattctagttggggtgatctttacgcgcaagatgtatgc
gccattaaaggttcaacggttcaaggtggacttgggccttttgggcttctaactttggct
tctaaaaacttagaagaatacacacccgttttcttccgagttttcaaggctcatgataaa
tacaaggttctcatgtgttccgatgcctcaaggtcaagcctaaagaatgaaactactatg
tataaaccatcatttgctggatatgtagatgtagatttagcagacaagaaattgtctctt
agaagtttgattgataattcgatagtggaaagttttggtgctgaaggaaaaacgtgcatt
acatcaagggtttatccaacgttggcgatatttgacaaagcacatttatttgccttcaat
aacggcgcggagacaatcacgattgagactctaaatgcttggagcatggctaatgctaag
ttgcactag

DBGET integrated database retrieval system