KEGG   Solanum pennellii: 107032142Help
Entry
107032142         CDS       T04130                                 

Definition
(RefSeq) (DL)-glycerol-3-phosphatase 2-like isoform X1
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
spen  Solanum pennellii
Brite
KEGG Orthology (KO) [BR:spen00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:spen01009]
    107032142
Enzymes [BR:spen01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     107032142
Protein phosphatases and associated proteins [BR:spen01009]
 HAD phosphatases
  Other HAD phosphatases
   107032142
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Hydrolase_6 HAD Isochorismatase
Motif
Other DBs
NCBI-GeneID: 107032142
NCBI-ProteinID: XP_015089203
Position
10
AA seq 246 aa AA seqDB search
MANQGIDTSSARKGSITHVIFDMDGLLLDTEKFYTEVQEIILARYNKTFDWSLKAKMMGK
KAIEAARVFVEETGISDSLTAEDFLVEREEMLQKMFPTSDLMPGASRLIHHLHENGIPIC
VATGTHTRHFDLKTQRHSELFSLMHHIVRGDDPEVKQGKPSPDIFLAAANRFEGGTVDPQ
RILVFEDAPSGVLAAKNAGMSVVMVPDARLDSQYHQVADQVLNSLLDFSPADWGLPPFEN
ASTKLD
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatcaaggcattgatacttcatctgcaagaaaaggctcaatcactcatgtaatc
tttgacatggatggacttcttctagacaccgagaaattctatacggaggtccaggagatt
atacttgctaggtataataagacttttgattggtcactcaaggcaaagatgatggggaag
aaggcaatagaggctgccagggtctttgttgaagagacaggaataagcgattcacttaca
gccgaagattttctggtagagagagaggagatgttgcagaaaatgttccccacaagcgac
ctcatgccaggggccagccgcttgattcatcaccttcatgaaaatgggataccaatttgt
gttgctacgggtactcacacgcggcactttgatttgaaaactcaaagacacagtgaactt
ttttcactaatgcatcatatcgttcgtggcgatgatccagaagttaaacaagggaagcca
tcacctgatatattccttgcagctgcgaacagatttgagggtggaacagtagatccacag
aggattcttgtatttgaagatgcaccctctggtgtcctcgcagccaagaatgctggaatg
tcagtggttatggttccagatgcaaggttggatagtcagtatcaccaagtcgctgatcag
gttttgaattctttacttgatttcagcccagccgattggggattgcctccatttgaaaat
gcatcaactaaactcgattag

DBGET integrated database retrieval system