KEGG   Staphylococcus pettenkoferi: CEP67_04795Help
Entry
CEP67_04795       CDS       T04943                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
spet  Staphylococcus pettenkoferi
Pathway
spet00051  Fructose and mannose metabolism
spet01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spet00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CEP67_04795
Enzymes [BR:spet01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     CEP67_04795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh Sacchrp_dh_NADP 3HCDH_N NAD_Gly3P_dh_N RNA_pol_Rpb4 UDPG_MGDP_dh_N DUF445
Motif
Other DBs
NCBI-ProteinID: ASE37978
Position
1002804..1003910
Genome map
AA seq 368 aa AA seqDB search
MKALHFGAGNIGRGFIGFILADNEVKVTFADVNETVIHELEQQHEYDVILADEERTTTRV
HNVDGINSSEPSEALKQAVLEADIITTAVGVNILPLIAKTFAPYLKEKETPVNIVACENA
IMATNTLKQAILDITGPLGDHIHFANSAVDRIVPEQHNENLLDVVVEPFFEWAIERQHWY
GPELDHIHYVDDLTPYIERKLLTVNTGHAFLAYAGRYHDKATVLDAMKDTQIKDGLKQVL
SETSQYITSKFTFTASQQAQYVDQIMERFENPNLSDAVTRVGRGTLRKIDPQDRIIKPLN
YLYQQDLPHEGLLKAAAYLLKYDDTNDKETVEKNNYIKNNGVEAFLKEYAHTDEGLTQEI
VREYNVLG
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccctacatttcggtgccggcaatatcggtcgcggtttcatcggtttcatcctt
gctgataatgaggtcaaagtgacctttgcggatgtcaacgagacggtgattcatgaactt
gagcaacaacatgaatacgatgtcattttagctgatgaagaacgtacgacgacacgcgtt
cacaatgttgatggtattaattctagtgaaccttcagaagcgttgaagcaagcggtgttg
gaagcagatattattactactgcagtcggcgtgaacattttaccacttatcgcaaagacg
tttgcgccgtatctgaaagagaaagaaacacccgtcaatatcgtggcgtgcgagaatgcg
attatggcaacaaatacgttgaaacaagccatcttagatattacaggtccactaggtgac
cacatccactttgcgaactcagctgttgaccgtattgttcctgaacagcataatgagaat
ttgttagatgtcgttgtcgaaccgttctttgaatgggcgattgaacgtcaacattggtat
gggcctgagttagatcatattcactatgtagatgatctcacaccttacatcgaacgtaag
cttctcacagtaaacacaggtcatgcgttcttagcttatgcaggacgttatcacgataaa
gccactgtgctcgatgctatgaaagatacacaaattaaagatggtttgaaacaagtcctt
tcagagactagccagtatattacgtctaaattcactttcactgcatctcaacaagcgcaa
tatgtggatcaaattatggaacgttttgagaatccaaatctctctgatgcggttacacgc
gttggccgaggtactttgcgtaaaattgatcctcaagatcgcattattaaaccgctcaat
tacctttatcaacaagatttacctcatgaaggattactgaaagctgcagcttatctgtta
aaatatgatgatacgaatgataaagagacagttgagaagaataattatattaaaaacaac
ggtgttgaagcatttcttaaagaatatgcgcacactgatgaaggtttaactcaagaaatt
gtacgtgaatacaatgtactaggttaa

DBGET integrated database retrieval system