KEGG   Staphylococcus pettenkoferi: CEP67_09185Help
Entry
CEP67_09185       CDS       T04943                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
spet  Staphylococcus pettenkoferi
Pathway
spet00450  Selenocompound metabolism
spet00970  Aminoacyl-tRNA biosynthesis
spet01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spet00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CEP67_09185
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CEP67_09185
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spet01007]
    CEP67_09185
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spet03016]
    CEP67_09185
Enzymes [BR:spet01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CEP67_09185
Amino acid related enzymes [BR:spet01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CEP67_09185
Transfer RNA biogenesis [BR:spet03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CEP67_09185
 Prokaryotic type
   Other AARSs
    CEP67_09185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Anticodon_1 ARL2_Bind_BART PilM
Motif
Other DBs
NCBI-ProteinID: ASE37451
Position
1956470..1958461
Genome map
AA seq 663 aa AA seqDB search
MAQETFYITTPIYYPSGNLHIGHAYTTTAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEK
ALEAGKTEKEYLDEMIAGIRALWDKLEISNDDFIRTTEERHKQVVQQIFERLLNQGDIYL
GEYEGWYSVPDETYYTETQLVDPVYEDGKIVGGKSPDSGHEVELVKEESYFFKLSKYTDQ
LLEFYDENPDFIQPASRKNEMINNFIKPGLEDLAVSRTSFDWGIRVKSNPKHVVYVWIDA
LVNYISSLGYLSDDDSLYQKYWPADIHIMAKEIVRFHSIIWPILLMALDLPLPKKVFAHG
WILMKDGKMSKSKGNVVDPNVLIDRYGLDATRYYLMRELPFGSDGVFTPEGFVERTNYDL
ANDLGNLVNRTISMINKYFDGELPAYQGQKHDIDPDLEQLATETVEVFHEKMDELQFSVA
LSTVWKLISRTNKYIDETTPWILAKDESQRDMLGNVMAHLVENIRYIAVLLRPFLTHAPK
QIFEQLNINTPELFEFESLTTYGALTEPIMVTEKPQPIFPRLDSEQEIAYIKESMQPPKA
DESNESEAAEEEEDSKPQIDIKAFDKVEIKAATITDAEQVKKSDKLLRIQVELANEQRQI
ISGIAKFYQPEDIIGKKVAVVTNLKPAKLMGQKSEGMILSAEKDGVLTLVSLPSAVPNGA
IIK
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggctcaagaaacattttatattacaacgccaatctactatcctagtggcaacctacat
atcggtcatgcctatactacaacagcaggagatgtcattgcgcgttataaaagaatgcaa
ggctatgatgtgcgctacctaactggaactgacgagcatggtcagaagattcaagagaaa
gcgctcgaagccggcaagacggagaaagaatacttagacgaaatgatcgcgggcattcgc
gcgttatgggacaaacttgaaatctctaacgacgactttattcgcacgacagaagagcgt
cataagcaagtcgtgcaacaaatctttgaacgtctgcttaaccaaggggacatctatctc
ggtgagtacgaaggttggtattctgttccggacgagacgtactatactgagacacaatta
gtggatccagtatatgaagacggtaagattgtcggaggtaaaagtccggattccggtcac
gaagttgaattagttaaagaagaaagctacttcttcaaactttctaaatatacggatcag
ctcttagaattctatgatgaaaacccagatttcattcaacctgcttctcgtaagaatgaa
atgattaataactttatcaagcctggacttgaagacttggcagtgtcacgtacatcattc
gattggggtatccgtgtgaaatcgaaccctaaacacgtagtctacgtttggattgacgca
ttagtgaactatatttcttcacttggctacttgtcagatgatgacagtttatatcaaaaa
tactggccagcagatatccatattatggcgaaagaaattgtacgtttccactctattata
tggccaatcttactcatggctttagaccttccacttcctaagaaagtctttgcgcacggt
tggattctcatgaaagatggcaagatgagtaaatctaaaggtaacgtggtggatcctaat
gtgctcatcgatcgttacggtttagatgcaacacgctattatttaatgcgtgaactccca
ttcggatctgatggtgtatttacacctgaaggtttcgtagagcgtacgaactatgactta
gcaaatgacttaggtaacttagtgaaccgtaccatctctatgattaacaaatatttcgat
ggtgagcttcctgcttaccaaggtcagaaacacgacattgacccagacttagaacaactt
gcgacagaaacagtagaagtgtttcatgagaagatggacgaacttcaattctcagtcgca
ttatctacagtatggaaactcatcagccgtactaataaatatattgacgaaacaacaccg
tggatactcgctaaagacgagtctcaacgcgatatgttaggcaacgttatggcgcactta
gtagagaatatccgttatattgcggtcttactacgtccgttcttaacacatgcgccgaaa
caaatctttgaacaactcaacatcaatacacctgagttattcgagtttgaaagcttaaca
acatatggtgcattaactgaacctattatggtgactgagaaaccacaaccaatcttccca
cgcttagatagcgaacaagagattgcatatattaaagaatctatgcaacctccgaaagcg
gatgaaagtaacgaaagtgaagcggcagaagaggaagaagatagcaaaccacagattgat
atcaaagcttttgataaagtagaaatcaaagcggccacaattacagatgcggaacaagtg
aagaagtctgacaaacttttacgcatccaagttgaactggctaacgaacaacgccaaatc
atctcaggtatcgctaagttctatcaacctgaggatattattggtaaaaaggttgcagta
gtgacgaacttgaaacctgcgaaactcatgggtcagaaatcggaaggtatgattctgtca
gctgaaaaggacggcgtattaacgttagtcagcttacctagtgccgtaccaaatggcgca
atcattaaataa

DBGET integrated database retrieval system