KEGG   Staphylococcus pettenkoferi: CEP67_09880Help
Entry
CEP67_09880       CDS       T04943                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
spet  Staphylococcus pettenkoferi
Pathway
spet00071  Fatty acid degradation
spet00072  Synthesis and degradation of ketone bodies
spet00280  Valine, leucine and isoleucine degradation
spet00310  Lysine degradation
spet00362  Benzoate degradation
spet00380  Tryptophan metabolism
spet00620  Pyruvate metabolism
spet00630  Glyoxylate and dicarboxylate metabolism
spet00640  Propanoate metabolism
spet00650  Butanoate metabolism
spet00900  Terpenoid backbone biosynthesis
spet01100  Metabolic pathways
spet01110  Biosynthesis of secondary metabolites
spet01120  Microbial metabolism in diverse environments
spet01130  Biosynthesis of antibiotics
spet01200  Carbon metabolism
spet01212  Fatty acid metabolism
spet02020  Two-component system
Brite
KEGG Orthology (KO) [BR:spet00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CEP67_09880
   00630 Glyoxylate and dicarboxylate metabolism
    CEP67_09880
   00640 Propanoate metabolism
    CEP67_09880
   00650 Butanoate metabolism
    CEP67_09880
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CEP67_09880
   00072 Synthesis and degradation of ketone bodies
    CEP67_09880
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CEP67_09880
   00310 Lysine degradation
    CEP67_09880
   00380 Tryptophan metabolism
    CEP67_09880
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CEP67_09880
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CEP67_09880
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CEP67_09880
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spet04147]
    CEP67_09880
Enzymes [BR:spet01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CEP67_09880
Exosome [BR:spet04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CEP67_09880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ASE37569
Position
2095367..2096509
Genome map
AA seq 380 aa AA seqDB search
MNKPVIVAAKRTPFGKYGGALRSLEPEMLLKPLFQHLSERCPELKYRTDDVILGNVVGNG
GNIARKSLLEAGWSETIPGLTLDRQCGSGLESIMYACRMIQAGAGQIYLAGGVESTSRAP
WKIKRPQSVYETTMPEIYERASFAPEGQDPSMIEAAENVAQRYDISRESQDDFAYQSHKR
TLQAYEEEHLADEILPLTVKGQRVDRDESVKPRLSEKLLSRMKPLISDGTVTAGNCCMKN
DGAVVLLVMEERTARALGYNHGLQFVDGLTHGVDPTLLGIGPIPTVETLLERNRTRMGDI
EAVELNEAFASQVLACQRELGISEAQLNRWGGAIAIGHPYGASGAALVTRLFNMKCDGLT
LATMGIGGGMGNAILFQPWT
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaccagttattgtagcggccaagcgtacgccgtttggaaagtatggcggtgcg
ctccggtctttagaaccagagatgctattaaaacctttatttcaacatttgagtgaacga
tgtccagaattaaaatatcgcactgatgatgtgatactcggtaacgtcgttggcaatgga
ggaaatattgcgcgtaaatcgttgcttgaagcaggatggtcggaaacgattcctgggctt
actttagatcgtcaatgtggttcaggattggaatctatcatgtatgcttgtcgaatgatt
caagcgggcgcagggcagatttatcttgctgggggtgttgaaagtacgagtagagcaccg
tggaagatcaagcggcctcaatctgtttatgaaacaacgatgccagaaatttatgaacgc
gcgtcatttgcgcctgagggacaagatccgtcgatgattgaagcggccgagaatgttgcc
cagcgctatgacatttcaagggaatcccaagatgattttgcttatcagagtcataaacgc
acattacaagcttatgaggaagagcacttagctgatgaaattcttcctttaacggtcaaa
gggcagcgtgtagacagagatgaaagcgtgaaaccgagacttagtgagaaattgttatca
cgcatgaagccactcatttctgacggaacggtcactgcaggcaactgctgtatgaaaaat
gacggggctgtagtgttgcttgtgatggaagagcgtactgcacgagcattaggttacaat
cacggactacaatttgtggatggtttaacgcatggtgttgatccaaccttattaggtatt
ggacctattccgacagtggaaacgttacttgagcggaatcgaacacggatgggtgatatc
gaagcagttgaattgaatgaagcctttgcttctcaagtgcttgcctgtcaaagggaactc
ggaatttctgaagcgcaactcaatcgttggggtggcgcgattgcgataggacacccttat
ggtgcaagtggtgcggcgctcgtgacccgattgttcaatatgaaatgtgacggtctgact
ttagcaactatgggcataggaggaggtatgggcaatgccatcttattccaaccttggacc
tga

DBGET integrated database retrieval system