KEGG   Streptococcus pyogenes Manfredo (serotype M5): SpyM50296
Entry
SpyM50296         CDS       T00497                                 
Symbol
ssb
Name
(GenBank) single strand binding protein (SSB)
  KO
K03111  single-strand DNA-binding protein
Organism
spf  Streptococcus pyogenes Manfredo (serotype M5)
Pathway
spf03030  DNA replication
spf03430  Mismatch repair
spf03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:spf00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SpyM50296 (ssb)
   03430 Mismatch repair
    SpyM50296 (ssb)
   03440 Homologous recombination
    SpyM50296 (ssb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spf03032]
    SpyM50296 (ssb)
   03400 DNA repair and recombination proteins [BR:spf03400]
    SpyM50296 (ssb)
   03029 Mitochondrial biogenesis [BR:spf03029]
    SpyM50296 (ssb)
DNA replication proteins [BR:spf03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    SpyM50296 (ssb)
DNA repair and recombination proteins [BR:spf03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     SpyM50296 (ssb)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    SpyM50296 (ssb)
Mitochondrial biogenesis [BR:spf03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    SpyM50296 (ssb)
SSDB
Motif
Pfam: SSB tRNA_anti-codon Cyclin_C_2 Phage_SSB
Other DBs
NCBI-ProteinID: CAM29638
Position
322608..323099
AA seq 163 aa
MINNVVLVGRMTKDAELRYTPSQVAVATFTLAVNRTFKSQNGEREADFINCVIWRQPAEN
LANWAKKGALIGITGRIQTRNYENQQGQRVYVTEVVADNFQMLESRATREGGSTGSFNGG
FNNNTSSSNSYSAPAQQTPNFGRDDSPFGNSNPMDISDDDLPF
NT seq 492 nt   +upstreamnt  +downstreamnt
atgattaataatgtagtactagttggtcgcatgaccaaggatgcagaacttcgttacaca
ccaagtcaagtagctgtggctaccttcacacttgctgttaaccgtacctttaaaagccaa
aatggtgagcgcgaggcagatttcattaactgtgtgatctggcgccaacctgctgaaaat
ttagcaaactgggctaaaaaaggtgccttgatcggaattacgggtcgtattcagacacgt
aactacgaaaaccaacaaggacaacgtgtctatgtaacagaagttgttgcagataatttc
caaatgttggaaagccgtgctacacgtgaaggtggctcaactggctcatttaatggtggg
tttaacaataacacttcatcatcaaacagttactcagcgcctgcacaacaaacacctaac
tttggaagagatgatagcccatttggcaattcaaacccgatggatatctcagatgacgat
cttccattctag

DBGET integrated database retrieval system