KEGG   Streptococcus pyogenes Manfredo (serotype M5): SpyM50702Help
Entry
SpyM50702         CDS       T00497                                 

Gene name
ddlA
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
spf  Streptococcus pyogenes Manfredo (serotype M5)
Pathway
spf00473  D-Alanine metabolism
spf00550  Peptidoglycan biosynthesis
spf01100  Metabolic pathways
spf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:spf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SpyM50702 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SpyM50702 (ddlA)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    SpyM50702 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:spf01011]
    SpyM50702 (ddlA)
Enzymes [BR:spf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SpyM50702 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:spf01011]
 Precursor biosynthesis
  Amino acid ligase
   SpyM50702 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 Cohesin
Motif
Other DBs
NCBI-ProteinID: CAM30035
UniProt: A2RDW0
Position
698516..699562
Genome map
AA seq 348 aa AA seqDB search
MSKQTLVLLYGGRSAEREVSVLSAESVMRAVNYDKFLVKTYFITQMGQFIRTQQFSEKPS
ESERLMTNETIELTQKIKPSDIYEEGAVVFPVLHGPMGEDGSIQGFLEVLRMPYIGTNVM
SSSIAMDKITTKRVLESIGIPQVAYTVYIDGQDLEACLVETLARLTFPIFVKPANMGSSV
GISKAQTKVELRKAIQLALTYDSRVLIEQGVVAREIEVGLLGNDKVKSTLPGEVIKDVDF
YDYQAKYVDNKITMAIPADVDQSIVTEMRSYAEVAFKALGGCGLSRCDFFLTQDGQVYLN
ELNTMPGFTQWSMYPLLWENMGLAYPDLIEELVTLAQEMFDQRESHLI
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaacaaacgttagttctattatacggaggccgctcagcagaacgtgaagtctca
gtgctttcagcagagagtgtgatgcgagcagtcaactatgataagttcttagtaaaaact
tattttattactcagatgggccaatttatcagaactcagcaattttcagaaaagccatcg
gaatcagaacgcttgatgacaaatgagacgatagagctaactcaaaaaataaaaccaagt
gatatctatgaagaaggtgcagttgtatttcctgtattacatggacctatgggagaagat
ggctctatccaaggtttcttagaagtgcttagaatgccatatatagggactaatgtcatg
tcttctagcatagctatggataaaattactactaaacgtgtcttagaatcaattggaatt
ccacaagttgcctatactgtttatattgacggacaagatttggaggcttgtttagttgaa
actttagcaagacttacttttcctatcttcgtaaaaccagctaatatgggttcttctgtg
gggatttccaaagcccaaacaaaagtagagttaagaaaagcgattcagttagccctgacc
tatgacagtcgtgttttgattgaacaaggcgtagttgccagagaaattgaagttggtctc
cttggaaatgataaggttaaatcaactctaccaggagaagtaatcaaggacgttgatttt
tacgactaccaagcaaaatatgttgataataagattacgatggccattccagcagatgta
gatcagagtattgtgacagaaatgcgttcttatgctgaagtagcctttaaagccttaggt
ggttgtgggttgtcccgttgtgactttttcttaacccaagacggacaggtttaccttaac
gaattaaacaccatgccaggctttacccaatggtctatgtatccactcttatgggaaaat
atgggattggcttatccagatttgattgaagagctggtgacactggcacaagaaatgttt
gaccagcgtgagagccatctgatttaa

DBGET integrated database retrieval system