KEGG   Streptococcus pyogenes Manfredo (serotype M5): SpyM50903Help
Entry
SpyM50903         CDS       T00497                                 

Definition
(GenBank) putative carboxylase subunit
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
spf  Streptococcus pyogenes Manfredo (serotype M5)
Pathway
spf00620  Pyruvate metabolism
spf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SpyM50903
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spf02000]
    SpyM50903
Enzymes [BR:spf01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     SpyM50903
Transporters [BR:spf02000]
 Other transporters
  Primary active transporters [TC:3]
   SpyM50903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: CAM30231
Position
complement(908545..909951)
Genome map
AA seq 468 aa AA seqDB search
MIQFGGFSMQQQVAITETVLRDGHQSLMATRLSIEDMLPVLTILDKIGYYSLECWGGATF
DACIRFLNEDPWERLRTLKKGLPNTRLQMLLRGQNLLGYRHYADDIVDKFISLSAQNGID
VFRIFDALNDPRNIQQALRAVKKTGKEAQLCIAYTTSPVHTLNYYLSLVKELVEMGADSI
CIKDMAGILTPKAAKELVSGIKAMTNLPLIVHTHATSGISQMTYLAAVEAGADRIDTALS
PFSEGTSQPATESMYLALKEAGYDITLDETLLEQAANHLRQARQKYLADGILDPSLLFPD
PRTLQYQVPGGMLSNMLSQLKQANAESKLEEVLAEVPRVRKDLGYPPLVTPLSQMVGTQA
AMNVILGKPYQMVSKEIKQYLAGDYGKTPAPVNEDLKRSQIGSAPVTTNRPADQLSPEFE
VLKAEVADLAQTNEDVLTYALFPSVAKPFLTTKYQTDDVIKVTAFIKA
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
ttgattcagtttggaggttttagcatgcagcagcaagtcgcaataacagaaacagtttta
cgggacggtcatcaaagtttgatggcaacgcgtttatctattgaggatatgcttcctgtc
cttaccatcttagacaagattggttattattccctagagtgttggggaggagcaaccttt
gatgcctgcattcgttttttgaacgaagacccttgggaaaggctgcgcacgttaaaaaaa
ggcttacctaatacccgtttacaaatgttattaagaggccaaaaccttttaggctaccgt
cattatgcagatgacatcgttgacaaattcattagtttatcagctcaaaatgggattgat
gttttccgcatttttgatgccctaaatgacccacgaaatatccagcaagccttaagagct
gtgaaaaagacgggtaaagaggctcaactgtgtattgcctatacaactagcccagtgcac
acgcttaactattacctttctttagtgaaagaattggttgagatgggagctgattctatc
tgcatcaaagatatggctggtattctaactcccaaagcggctaaagagttagtatctggt
atcaaagccatgactaacttacctcttattgtgcatacccatgcaactagtggcatttct
cagatgacctatctagcagcagtagaagctggtgctgatagaattgataccgctttgtca
ccttttagcgaaggcacttcacaacctgctacagaatccatgtatttagccttaaaagaa
gcaggttatgatatcacattagatgaaacactactggaacaggctgctaatcaccttcga
caagcccgtcaaaagtacttagcagatggcattctggatcccagtcttctctttccagac
ccaaggacactacaataccaagttcctggaggcatgttatctaatatgctatctcagctg
aaacaagccaatgccgaatcaaaattagaagaggttttagcagaagttcctcgggtaaga
aaagacttgggttatcctcccttagtaacaccgcttagccaaatggtcgggactcaagct
gctatgaatgtgattttaggaaaaccttaccagatggtgtctaaggaaattaaacaatac
ttggcaggcgactatggcaaaacaccagcaccagtcaacgaagacttaaaacgaagtcaa
attggctcagctcctgtcaccacaaatcgtcctgcagatcaactaagtcctgaattcgag
gtgttaaaagcagaagtagcagatttagcccaaacgaacgaagatgtgctgacttatgcc
ctctttccaagcgtagcaaaaccgtttttaacaaccaaataccaaactgatgacgtcatt
aaagtgactgcctttatcaaagcataa

DBGET integrated database retrieval system