KEGG   Streptococcus pyogenes Manfredo (serotype M5): SpyM50992Help
Entry
SpyM50992         CDS       T00497                                 

Definition
(GenBank) haloacid dehalogenase-like hydrolase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
spf  Streptococcus pyogenes Manfredo (serotype M5)
Pathway
spf00627  Aminobenzoate degradation
spf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:spf00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SpyM50992
Enzymes [BR:spf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     SpyM50992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 Hydrolase_3
Motif
Other DBs
NCBI-ProteinID: CAM30319
Structure
PDB: 

Position
complement(997463..998227)
Genome map
AA seq 254 aa AA seqDB search
MPYKGYLIDLDGTIYQGKNRIPAGERFIKRLQERGIPYLLVTNNTTRTPEMVRSMLANQF
HVETGIETIYTATMATVDYMNDMNRGKTAYVIGETGLKSAIAAAGYVEELENPAYVVVGL
DSQVTYEMLAIATLAIQKGALFIGTNPDLNIPTERGLMPGAGALNALLEAATRVKPVFIG
KPNAIIMNKSLEVLGIQRSEAVMVGDNYLTDIMAGIQNDIATILVTTGFTRPEEVPTLPI
QPDHVLSSLDEWRL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
gtgccttataagggttatttaattgatttagacggaacgatttaccaagggaaaaaccgt
attccagcaggggagcggtttatcaaacgcctacaagaaagaggcattccctatttatta
gtgactaataataccacaagaacacccgaaatggtgcgaagcatgctggctaatcagttt
catgttgagacaggcattgagaccatttatacggctaccatggcaaccgtcgattacatg
aatgacatgaaccgtggcaagacagcttacgttattggagaaacagggctcaaatcagcg
attgcagcagcaggttacgtagaagaacttgagaatcccgcttacgtggtggttggttta
gacagtcaggtgacctatgagatgttggctatagccaccttggctattcaaaaaggtgcc
ctctttattgggacaaatcctgatttaaacattccaaccgaacgtggtttgatgccagga
gcaggtgcattgaatgccttactagaagctgccacacgtgtaaaacctgtttttattggc
aagcccaacgctatcattatgaataaatcactagaggtattgggcattcagcgctctgag
gctgtcatggttggcgataattacttgactgatatcatggcaggtattcaaaatgatatt
gcaacgatcctcgtgacaacaggctttaccagacctgaagaggtaccaaccttaccaatt
cagccagatcatgtcctatctagtcttgatgagtggaggttgtga

DBGET integrated database retrieval system