KEGG   Streptococcus pyogenes Manfredo (serotype M5): SpyM51384Help
Entry
SpyM51384         CDS       T00497                                 

Gene name
bglA
Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
spf  Streptococcus pyogenes Manfredo (serotype M5)
Pathway
spf00010  Glycolysis / Gluconeogenesis
spf00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:spf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SpyM51384 (bglA)
   00500 Starch and sucrose metabolism
    SpyM51384 (bglA)
Enzymes [BR:spf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SpyM51384 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: CAM30712
Position
complement(1373482..1374906)
Genome map
AA seq 474 aa AA seqDB search
MGIFPKDFLWGGAVAANQVEGAFEADAKGLSVQDVLPNGGLGEWTDSPTSDNLTLEAIDF
YHRYKEDIALFAEMGFKVFRTSIAWSRIFPNGDDDQPNEAGLQFYDDLFDELLNYGIEPL
VTLSHYETPLHLAKAYNGWTDRRLIGFFEHFAQTVMERYKDKVKYWLTFNEVNSILHMPF
TSGGIMTEKEKLSLQDLYQAIHHELVASASVTKLAHEINPDVKVGCMILAMPAYPMTSDP
RDILAAHAFENLNLLFSDIHVRGKYPSYIKSYFKENGIEIVFEDGDKELLAEHTVDFLSF
SYYMSVTQAHNPEAYTSGQGNILGGLSNPYLESSEWGWQIDPIGLRLVLNQYYDRYQIPL
FIVENGLGAKDQLVQTADGSMTVHDDYRIDYMSQHLVQVAKAIEDGVEVMGYTAWGCIDC
VSMSTAQLSKRYGFIYVDRNDDGTGQLTRYKKKSFDWYRQVIQTNGRYLEDNFS
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgggaatttttccaaaagatttcttatggggcggcgcagtagctgccaaccaagtggaa
ggagcatttgaggcagacgcaaaaggtttgtccgtacaagatgttctaccaaatggtgga
ctaggagaatggacagatagtcctaccagcgataatttaacattagaggcgattgatttt
taccaccgctacaaagaagacattgctctttttgccgagatgggctttaaagtctttcga
acgtctattgcttggtctcgtatttttccaaatggtgacgatgaccagcccaatgaagca
ggtttgcaattttatgatgacttattcgatgaattgttgaactatggcatcgaaccctta
gtgaccttgtcgcattatgagacacctctgcatttggccaaagcctataatggttggaca
gatagacgtctgattggcttttttgagcactttgctcagacagtcatggaacgctataag
gacaaagtcaaatactggttgaccttcaacgaagtcaactcgattttacacatgcccttt
accagtggtggcatcatgacagaaaaagaaaagctgagcctgcaagatttataccaagcg
attcatcatgaattggtagcatctgctagtgtcacaaagctagcgcatgaaatcaatcct
gatgttaaagttgggtgtatgattttggcgatgcctgcttacccaatgacctctgatcct
cgtgatatacttgctgcgcatgcatttgaaaatcttaatctcttattttcagatattcat
gtgagaggcaagtatccttcatatattaagtcgtattttaaagaaaatgggattgagatt
gtttttgaagacggagacaaggaattattagcggaacatacggttgattttctatccttt
agctattacatgagtgtcacacaagcccacaatcctgaagcttacacatctggtcaggga
aatattctaggtggtttgtccaatccatatttagaatcttcggagtggggttggcagata
gacccaattggtctgcgattggtcttgaatcagtactatgaccgctaccagattcctttg
tttattgttgaaaatggcttaggtgcaaaggatcagctggtgcaaaccgcagatggcagc
atgacggttcacgatgattatcgcattgactacatgagtcagcatctcgtacaagttgcc
aaagcgattgaagatggcgttgaggtcatgggttacactgcttggggctgtattgattgt
gtctctatgtcaacagcccaattaagtaagcgctacggttttatttatgttgaccgaaat
gatgatggtactggtcaactcacacgctataagaaaaaatcatttgattggtaccgacaa
gtcattcaaaccaatggacgttaccttgaggataatttttcctaa

DBGET integrated database retrieval system