KEGG   Streptococcus pyogenes Manfredo (serotype M5): SpyM51432Help
Entry
SpyM51432         CDS       T00497                                 

Definition
(GenBank) putative thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
spf  Streptococcus pyogenes Manfredo (serotype M5)
Pathway
spf00071  Fatty acid degradation
spf00072  Synthesis and degradation of ketone bodies
spf00280  Valine, leucine and isoleucine degradation
spf00310  Lysine degradation
spf00362  Benzoate degradation
spf00380  Tryptophan metabolism
spf00620  Pyruvate metabolism
spf00630  Glyoxylate and dicarboxylate metabolism
spf00640  Propanoate metabolism
spf00650  Butanoate metabolism
spf00900  Terpenoid backbone biosynthesis
spf01100  Metabolic pathways
spf01110  Biosynthesis of secondary metabolites
spf01120  Microbial metabolism in diverse environments
spf01130  Biosynthesis of antibiotics
spf01200  Carbon metabolism
spf01212  Fatty acid metabolism
spf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:spf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SpyM51432
   00630 Glyoxylate and dicarboxylate metabolism
    SpyM51432
   00640 Propanoate metabolism
    SpyM51432
   00650 Butanoate metabolism
    SpyM51432
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SpyM51432
   00072 Synthesis and degradation of ketone bodies
    SpyM51432
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SpyM51432
   00310 Lysine degradation
    SpyM51432
   00380 Tryptophan metabolism
    SpyM51432
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SpyM51432
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SpyM51432
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SpyM51432
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spf04147]
    SpyM51432
Enzymes [BR:spf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SpyM51432
Exosome [BR:spf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SpyM51432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAM30753
Position
complement(1415680..1416828)
Genome map
AA seq 382 aa AA seqDB search
MTDVYIAAGLRTPIGLVGKQFAKEQPEILGAKLINALQNKYPVPIDQVICGNTVGTGGNI
GRLMTLYSHLGESVSALTVDMQCASAGAALSVGYAKIKAGMASNLLVGGIESSSLQPESV
YASADWRQGAYKVAQFSPDSISPFAMIEGAERVAREHGFTKEYLNHWTLRSHQKASYCQE
QALLADLILDLPGASDQGIRPRLSSKVLSKVPPILGEDHVISAANACLTHDAAAFLQLSS
QPSAFKLIDVVEVAGDPQRSPLMVIKASQVLLEKYGLGMADMTAIEWNEAFAVIDGLFET
HYPDLLDRYNIFGGALAYGHPYGASAAIIILHLMRALEIKNGRYGIAAIAAAGGQGFAVL
LKYHKEFSHADKARILGKAMPK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgacggatgtttatattgctgcaggccttagaacccctatcggtttagtagggaaacaa
tttgctaaagaacaaccagaaatccttggagcaaagctcatcaatgctttacaaaataag
tatccagttcccattgaccaagtgatttgtggcaataccgtcggaacgggtggtaatatt
gggcgcttgatgaccctgtattctcatttaggagaatctgtctctgctttgacggttgat
atgcagtgtgcatcagctggtgcagctctttccgtgggttatgctaaaatcaaggcaggt
atggcaagcaaccttttagtgggagggattgaaagcagctccttacaacctgaatcggta
tatgcttcagctgattggcgccaaggagcctacaaggtagctcagttttctccagatagt
atcagcccttttgcgatgattgaaggggcagaacgagtggcaagagagcatggctttaca
aaggagtatttgaatcactggacattgagaagtcatcaaaaggctagttattgccaggag
caagccctgttagctgatcttattctagacctgccaggagccagtgatcaaggtattcga
ccgcgcttgtcaagtaaggtgttgtcaaaggtaccccctatcttaggagaagatcacgtg
attagtgcagccaatgcctgcctcacccatgatgctgctgcctttttacagctaagtagt
cagccttcagcttttaaactgattgatgtggtagaagtagcaggagacccacagcgtagc
cctttaatggtgattaaggctagtcaagtccttttggaaaaatatggtctagggatggca
gatatgacagcgattgaatggaacgaagcctttgccgttattgatggtctatttgaaacc
cattatccagatttattggaccgctataatatatttggtggtgcattagcttatggtcat
ccctatggtgcctcagcagccattataatattgcacttaatgagggctttagagattaaa
aatggacgctatggaatagctgctatagcagcagctggtggccaagggtttgctgtttta
ctaaaatatcataaggagtttagtcatgctgacaaagctagaatattgggcaaagcaatg
cccaaataa

DBGET integrated database retrieval system