KEGG   Streptococcus pyogenes MGAS315 (serotype M3): SpyM3_1261
Entry
SpyM3_1261        CDS       T00089                                 
Name
(GenBank) putative P1-type antirepressor - phage-associated
  KO
K07741  anti-repressor protein
Organism
spg  Streptococcus pyogenes MGAS315 (serotype M3)
Brite
KEGG Orthology (KO) [BR:spg00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    SpyM3_1261
SSDB
Motif
Pfam: ANT AntA Peptidase_C3 Bro-N
Other DBs
NCBI-ProteinID: AAM79868
UniProt: A0A0H2UVC9
Position
complement(1267531..1268259)
AA seq 242 aa
MNNLITVTLNENQEPIVSGRDLHQALEIKTQYTKWLERMSDYGFEENEDYVAISQKRLTA
QGNQTEYTDHVLKLDMAKEIAMLQRNEKSKQVRKYFIQIEKDFNSPEKIMARALLMADKK
VHKLEAQIEADRPKVLFADAVSASKSSCLIGELAKILKQNGVNIGQNKLFQWLRANGYLI
SRRGESWNQPTQKSMQLGLFELKKTAINHSDGHTTTNVTPKVTGKGQQYFINKFFNQEYL
PV
NT seq 729 nt   +upstreamnt  +downstreamnt
atgaataatcttatcacagtaacactaaacgaaaaccaagaacctattgtttctggtcga
gatttgcatcaagcattagaaattaaaactcagtacacaaaatggttagaacgaatgtct
gattatgggtttgaagaaaatgaagactatgtagctattagtcaaaaaagactaacagct
cagggcaatcaaacagaatatacagaccacgttctaaaactagacatggctaaagaaatt
gcgatgcttcaacggaacgaaaagtctaaacaagtccgcaaatactttatccaaatcgaa
aaagacttcaacagccctgagaaaatcatggcaagggcgttgctgatggcggataagaaa
gtgcataaacttgaagcacaaatcgaggcagaccgtcccaaagtactatttgctgatgct
gtaagtgctagcaaatcatcttgtctgattggtgagttagctaaaatcctgaaacagaat
ggagtcaatattggtcagaataagctatttcagtggttacgagccaacggctacctaatc
agtcgccgtggtgagtcttggaatcagccaacgcaaaaaagtatgcagcttggattgttt
gaactcaaaaaaacagccatcaatcactctgacggtcacactacaacaaatgtaacccca
aaagttactggtaaagggcaacaatactttattaataaattctttaaccaggaatatctg
ccagtttag

DBGET integrated database retrieval system