KEGG   Streptococcus pyogenes MGAS315 (serotype M3): SpyM3_0233
Entry
SpyM3_0233        CDS       T00089                                 

Symbol
atmB
Name
(GenBank) putative lipoprotein
  KO
K02073  D-methionine transport system substrate-binding protein
Organism
spg  Streptococcus pyogenes MGAS315 (serotype M3)
Pathway
spg02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:spg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SpyM3_0233 (atmB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spg02000]
    SpyM3_0233 (atmB)
Transporters [BR:spg02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   D-Methionine transporter
    SpyM3_0233 (atmB)
SSDB
Motif
Pfam: Lipoprotein_9 Phosphonate-bd NMT1 SecD-TM1
Other DBs
NCBI-ProteinID: AAM78840
UniProt: A0A0H2UTD1
Position
272310..273155
AA seq 281 aa
MSFKKWIGIVGIALASTVLVACSEKQDDKNTLTIGVMTKTESDQARWDKVEELLKKDNIT
LKYKEFTDYSQPNKAVANGEVDINAFQHYNFLNNWNKENKEHLVAIADTYISPINLFSGT
SQDGKAKYKSVADLPNGAQIAVPNDATNESRALYVLQSAGLIKLDVSGDQLATIANISEN
KKKLDIKELDASQTARALVSADAAVVNNSYAVPAKIDYKTSLFKEKADDNSKQWINIIAG
QKDWEKSEKADAIKKLIKAYQTDEVKKVVEKTSNGIDVSVW
NT seq 846 nt   +upstreamnt  +downstreamnt
atgtcttttaaaaaatggattggaatagtcggaatcgctttagcatcaactgtattggtt
gcatgttctgaaaaacaagatgataaaaacactctaactattggggtgatgacaaaaaca
gaatctgatcaagcgagatgggataaagttgaagaattattgaaaaaagacaatatcact
ttgaagtacaaagaatttacagattactcgcaacctaataaggcagttgctaatggtgaa
gtcgatattaatgccttccaacactataatttcttaaataactggaataaggaaaataag
gaacatttggtggccattgctgatacctatatcagcccaattaaccttttctctggaacc
agtcaagatgggaaggctaaatacaaatcagtagctgatctgccaaatggtgctcaaatt
gcagtaccaaatgatgcgaccaatgaaagccgtgccctctatgtgctgcaatcagctggc
ctcattaaattggatgtgtctggtgatcaattagcaaccattgccaatatctcagagaac
aaaaagaaattagatatcaaggaattagatgctagccaaacggcacgtgctttagtatct
gctgatgcagctgttgtcaataatagttacgctgttcctgcaaaaattgactacaaaacc
tctcttttcaaagaaaaagcagatgacaattcaaaacagtggattaacattattgcaggt
caaaaagattgggaaaaatcagagaaggctgatgctattaaaaaactcatcaaggcctac
caaactgatgaggtgaagaaagtcgtggaaaaaacttcaaatggtatagatgtatccgta
tggtaa

DBGET integrated database retrieval system