KEGG   Streptococcus pyogenes MGAS315 (serotype M3): SpyM3_0369Help
Entry
SpyM3_0369        CDS       T00089                                 

Definition
(GenBank) putative acetyl coenzyme A acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
spg  Streptococcus pyogenes MGAS315 (serotype M3)
Pathway
spg00071  Fatty acid degradation
spg00072  Synthesis and degradation of ketone bodies
spg00280  Valine, leucine and isoleucine degradation
spg00310  Lysine degradation
spg00362  Benzoate degradation
spg00380  Tryptophan metabolism
spg00620  Pyruvate metabolism
spg00630  Glyoxylate and dicarboxylate metabolism
spg00640  Propanoate metabolism
spg00650  Butanoate metabolism
spg00900  Terpenoid backbone biosynthesis
spg01100  Metabolic pathways
spg01110  Biosynthesis of secondary metabolites
spg01120  Microbial metabolism in diverse environments
spg01130  Biosynthesis of antibiotics
spg01200  Carbon metabolism
spg01212  Fatty acid metabolism
spg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:spg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SpyM3_0369
   00630 Glyoxylate and dicarboxylate metabolism
    SpyM3_0369
   00640 Propanoate metabolism
    SpyM3_0369
   00650 Butanoate metabolism
    SpyM3_0369
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SpyM3_0369
   00072 Synthesis and degradation of ketone bodies
    SpyM3_0369
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SpyM3_0369
   00310 Lysine degradation
    SpyM3_0369
   00380 Tryptophan metabolism
    SpyM3_0369
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SpyM3_0369
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SpyM3_0369
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SpyM3_0369
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spg04147]
    SpyM3_0369
Enzymes [BR:spg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SpyM3_0369
Exosome [BR:spg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SpyM3_0369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AAM78976
UniProt: A0A0H2UTG4
Position
409827..410975
Genome map
AA seq 382 aa AA seqDB search
MTDVYIAAGLRTPIGLVGKQFAKEQPEILGAKLINALQNKYPAPIDQVICGNTVGTGGNI
GRLMTLYSHLGESVSALTVDMQCASAGAALSVGYAKIKAGMASNLLVGGIESSSLQPESV
YASADWRQGAYKVAQFSPDSISPFAMIEGAERVAREHGFTKEYLNHWTLRSHQKASYCQE
QALLADLILDLPGASDQGIRPRLSSKVLSKVPPILGEDHVISAANACLTHDAAAFLQLSS
QPSAFKLIDVVEVAGDPQRSPLMVIKASQVLLEKHGLGMADMTAIEWNEAFAVIDGLFET
HYPDLLDRYNIFGGALAYGHPYGASAAIIILHLMRALEIKNGRYGIAAIAAAGGQGFAVL
LKYHKEFSHADKARILGKAMPK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgacggatgtttatattgctgcaggccttagaacccctatcggtttagtagggaaacaa
tttgctaaagagcagccagaaatccttggagcaaagctcatcaatgctttacaaaataag
tatccagctcctattgaccaagtgatttgtggcaataccgtcggaacgggtggtaatatt
gggcgcttgatgaccctgtattctcatttaggagaatctgtctctgctttgacggttgat
atgcagtgtgcatcagctggtgcagctctttccgtgggttatgctaaaatcaaggcaggt
atggcaagcaaccttttagtgggagggattgaaagcagctccttacaacctgaatcggta
tatgcttcagctgattggcgccaaggagcctacaaggtagctcagttttctccagatagt
atcagcccttttgcgatgattgagggggcagaacgagtggcaagagagcatggctttaca
aaggagtatttgaatcactggacattgagaagtcatcaaaaggctagttattgccaggag
caagccctgttagctgatcttattctagacctgccaggagccagtgatcaaggtattcga
ccgcgcttgtcaagtaaggtgttgtcaaaggtaccccctatcttaggagaagatcacgtg
attagtgcagccaatgcctgcctaacccatgatgctgctgcctttttacagctaagtagt
cagccttcagcttttaaactgattgatgtggtagaagtagcaggagacccacagcgtagc
cctttaatggtgattaaggctagtcaagtccttttggaaaaacatggtctagggatggca
gatatgacagcgattgaatggaacgaagcctttgccgttattgatggtctatttgaaacc
cattatccagatttattggaccgctataatatatttggtggtgcattagcttatggtcat
ccctatggtgcctcagcagccattataatattgcacttaatgagggctttagagattaaa
aatggacgctatggaatagctgctatagcagcagctggtggccaagggtttgctgtttta
ctaaaatatcataaggagtttagtcatgctgacaaagctagaatattgggcaaagcaatg
cccaaataa

DBGET integrated database retrieval system