KEGG   Streptococcus pyogenes MGAS315 (serotype M3): SpyM3_0836Help
Entry
SpyM3_0836        CDS       T00089                                 

Gene name
oadA
Definition
(GenBank) putative oxaloacetate decarboxylase alpha chain
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
spg  Streptococcus pyogenes MGAS315 (serotype M3)
Pathway
spg00620  Pyruvate metabolism
spg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SpyM3_0836 (oadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spg02000]
    SpyM3_0836 (oadA)
Enzymes [BR:spg01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     SpyM3_0836 (oadA)
Transporters [BR:spg02000]
 Other transporters
  Primary active transporters [TC:3]
   SpyM3_0836 (oadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA His_biosynth ADH_zinc_N Sulfotransfer_4
Motif
Other DBs
NCBI-ProteinID: AAM79443
UniProt: A0A0H2UUE9
Position
888702..890096
Genome map
AA seq 464 aa AA seqDB search
MTKIRITETVLRDGQQSQIATRMTTKEMIPILETLDNAGYHALEMWGGATFDSCLRFLNE
DPWERLRAIRKAVKKTKLQMLLRGQNLLGYRNYADDVVRSFVQKSIENGIDIVRIFDALN
DPRNLQTAVSATKKFGGHAQVAISYTTSPVHTIDYFVELAKAYQAIGADSICIKDMAGVL
TPEIGYQLVKRIKENTTIPLEVHTHATSGISEMTYLKVAEAGADIIDTAISSFSGGTSQP
ATESMAIALTDLGFDTGLDMQEVAKVAEYFNTIRDHYRETGILNPKVKDTEPKTLIYQVP
GGMLSNLLSQLTEQGLADKYEEVLAEVPKVRADLGYPPLVTPLSQMVGTQALMNIISGER
YKVVPNEIKDYVRGLYGQSPAPLAEGIKEKIIGDEAVIACRPADLIEPQMIYLRDEIAPY
ARSEEDVLSYASFPQQARDFLGRREDPFYDVPVQEVTVQLDIQD
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaatccgtataacggaaacagttttacgtgatggtcaacaaagtcagattgcc
acacgtatgacaaccaaggaaatgattcctattctcgaaacgctagacaatgctggttat
catgcccttgaaatgtggggaggagcaacctttgattcctgcctacgctttttaaatgaa
gacccttgggaacggctaagagccatccgtaaagcagtgaaaaagactaaacttcagatg
ctcttacgcggacaaaaccttcttggatatcgcaattatgctgacgatgtggtcagatcc
ttcgttcaaaaatccattgaaaacgggattgatattgtccgtatcttcgatgctttaaat
gaccctcgcaacttgcaaacagctgtttcagcgactaaaaaatttggagggcatgctcaa
gttgccatttcttacacgacaagtccggtacataccattgattactttgttgaattggcg
aaagcttaccaagctatcggagctgactccatttgtatcaaagacatggctggtgtctta
actcctgaaataggttaccaattggtcaaacgtatcaaggagaatacaactatccctctt
gaagttcatacccatgctaccagtggtatttcagaaatgacttacttaaaagtggcagaa
gcaggagctgatattattgatacagcgatttcctctttttcagggggaaccagtcagcct
gccacagaatcaatggcgattgccttgacggatttaggctttgacacaggcttggatatg
caagaggtagccaaagttgcagaatatttcaataccattcgtgaccactaccgagagaca
gggattttaaatcctaaagtcaaagatactgagccaaaaacattgatttaccaagttcca
ggtggcatgctatcaaacctattgagccaattaaccgagcaaggcctagctgataaatac
gaagaagtcttagcagaagtacctaaagtaagggccgatcttggatatccaccacttgta
acgccattatcacaaatggttggcacacaggccttgatgaatatcatctcaggggaacgc
tacaaggtagttccaaatgaaatcaaagactatgttcgagggctatacggtcaatcacca
gcgccactagcagaaggtatcaaagagaaaatcattggtgacgaagcagtcattgcttgc
agaccagccgacctaatcgagcctcaaatgatttatctacgtgacgagattgctccatac
gctcgttcagaagaagacgtgttaagctatgcgagtttcccacagcaagccagagatttc
ttgggacgccgtgaagatcctttctatgatgttccggttcaagaagttactgtacaactg
gacattcaagactaa

DBGET integrated database retrieval system