KEGG   Streptococcus pyogenes MGAS315 (serotype M3): SpyM3_1475Help
Entry
SpyM3_1475        CDS       T00089                                 

Gene name
nagA
Definition
(GenBank) putative N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
spg  Streptococcus pyogenes MGAS315 (serotype M3)
Pathway
spg00520  Amino sugar and nucleotide sugar metabolism
spg01100  Metabolic pathways
spg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:spg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SpyM3_1475 (nagA)
Enzymes [BR:spg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     SpyM3_1475 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3 VPS13_C
Motif
Other DBs
NCBI-ProteinID: AAM80082
UniProt: A0A0H2UW69
Position
complement(1470083..1471231)
Genome map
AA seq 382 aa AA seqDB search
MTCYLKADCFYYPTEVKPAGYLSLHDGVFGEWTEIVPADAQIIDYTGYQIAPGLVDTHIH
GYAGADVMDNSAQGIHQMSEGLLATGVTSFLPTTLTSTFEQLEKVSGTIASVADQVKGAK
IQGIYFEGPYFTEEYKGAQNPSYMKTPRLEEFDAWQKAAKGLIKKIALAPEREGVKEFVS
AVTKQGVTVALGHSNGTYQEAKEAVQAGASVWVHAYNGMRGLTHREPGMVGAVYNLPNTY
AELICDGHHVSPIACDILMQQKGHDHVAMITDCMRAGGSPDGDYLLGEFSVVVANGTARL
KESGNLAGSILKLKDGLRNVVAWGIATPAEAIHMATYVPAVSVGIDDVCGQIKAGHAADF
IVLDKDLTLVATYLNGQKAFDA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgacatgctatcttaaagcagattgtttttattacccaacagaggtgaaaccggctggc
tacctaagtcttcatgatggtgtttttggggagtggacagaaattgttccggcagatgcg
caaatcattgactacaccggttatcaaattgcaccaggtcttgtggatacgcatatccat
ggctatgcgggagctgatgtcatggataattctgcccaagggattcatcaaatgagtgaa
ggactattagcaacaggagtaacgtcttttttaccgacgaccttaacttctacctttgag
cagttagaaaaagtatcagggactattgcttcagttgctgatcaagtaaaaggtgctaaa
atacaaggtatctactttgaaggtccttattttaccgaagaatataagggtgctcaaaac
ccaagttatatgaaaaccccacgcttggaggaatttgatgcttggcaaaaagctgctaaa
gggctcatcaaaaaaattgcccttgctcctgagcgtgagggtgtcaaagaatttgtgtcc
gcagtgacaaaacaaggcgtaacagtggccttagggcattcaaacggtacttatcaagag
gctaaagaagctgttcaagctggtgctagtgtttgggttcatgcttataatggcatgcga
ggattgacccaccgtgaaccaggaatggtgggagcggtttataatcttccaaatacttac
gcagagttgatttgtgatggccaccatgtctcaccaattgcttgtgatattttgatgcag
caaaaagggcatgatcatgtagctatgattacggactgtatgcgagcaggtggttcacca
gatggtgattacctcttgggagaattctctgtggttgtggcaaatggcactgctcgtctt
aaagagagtggaaacttggcaggatctattttgaaattaaaagacggccttagaaatgta
gtggcctggggaatcgcaactccggcagaagccattcatatggcaacctatgtgccagct
gtttctgtcggtattgacgacgtatgtggtcaaatcaaagctgggcatgcggctgacttt
attgttcttgataaggatttaacacttgttgcaacctatttaaatgggcaaaaagctttt
gatgcctaa

DBGET integrated database retrieval system