KEGG   Streptococcus pyogenes MGAS315 (serotype M3): SpyM3_1527Help
Entry
SpyM3_1527        CDS       T00089                                 

Gene name
fabH
Definition
(GenBank) putative beta-ketoacyl-[ACP] synthase III
  KO
K00648  3-oxoacyl-[acyl-carrier-protein] synthase III [EC:2.3.1.180]
Organism
spg  Streptococcus pyogenes MGAS315 (serotype M3)
Pathway
spg00061  Fatty acid biosynthesis
spg01100  Metabolic pathways
spg01212  Fatty acid metabolism
Module
spg_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:spg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SpyM3_1527 (fabH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:spg01004]
    SpyM3_1527 (fabH)
Enzymes [BR:spg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.180  beta-ketoacyl-[acyl-carrier-protein] synthase III
     SpyM3_1527 (fabH)
Lipid biosynthesis proteins [BR:spg01004]
 Fatty acid synthase
  Component type
   SpyM3_1527 (fabH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACP_syn_III_C ACP_syn_III Thiolase_N FAE1_CUT1_RppA Chal_sti_synt_C RNA_Me_trans
Motif
Other DBs
NCBI-ProteinID: AAM80134
UniProt: P0DB00
Position
complement(1518275..1519249)
Genome map
AA seq 324 aa AA seqDB search
MIFSKISQVAHYVPQQLVTNNDLASIMDTSHEWIFSRTGIAERHISRDEMTSDLAIQVAD
QLLTQSGLKADAIDFIIVATISPDATMPSTAAKVQAAIAATSAFAFDMTAACSGFVFALA
MADKLIASGAYQNGMVIGAETLSKLVNWQDRATAVLFGDGAGGVLLEASKDKHVLAETLH
TDGARCQSLISGETSLSSPYSIGKKAIATIQMDGRAIFDFAIRDVSKSILTLMAQSDITK
DDIDYCLLHQANRRILDKIARKIDVPREKFLENMMRYGNTSAASIPILLSEAVQKGQIRL
DGTQKILLSGFGGGLTWGSLIVKI
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgattttttctaaaatcagtcaggtagcccactatgttccacagcagttagtgactaat
aatgatttagctagcataatggacactagtcatgagtggatcttttctcgaacaggaata
gcagaacgccatatttctagagatgaaatgactagtgacctagctattcaggttgctgat
cagcttttaactcagtctgggttaaaagctgatgctattgattttattattgttgcaact
atcagccctgatgccactatgccatcaacagctgcgaaagttcaagcagctattgcggct
acaagtgcttttgcttttgatatgactgctgcttgtagtggctttgtctttgccttggct
atggcagataagcttattgcatcaggtgcctaccaaaacggaatggtaataggtgcagag
actttatctaagttagtaaattggcaggatcgagcgacagccgttctttttggagatgga
gctggtggcgtgctactggaagccagtaaagataaacatgttttagcggaaacattacac
acagatggtgcgagatgtcagagtttaatttcaggagaaactagtctttcatctccgtac
tcaattggcaaaaaagccatagcgactattcagatggatggacgtgccatatttgatttt
gcgattagggatgtgtcaaaaagcatcctcacactaatggcgcaatcagatattacaaaa
gatgatatagactattgtttattgcatcaagctaatcgtcgtatacttgataaaatagca
cgcaagattgatgttcctcgggaaaaattccttgaaaacatgatgcgttatggtaatact
agtgctgctagtatcccaatcctcttgtcagaggctgttcaaaagggacagattaggtta
gatggtacccaaaaaatcttactttccggttttggtggaggtttgacatggggaagtcta
attgttaaaatctag

DBGET integrated database retrieval system