KEGG   Streptococcus pyogenes MGAS315 (serotype M3): SpyM3_1803Help
Entry
SpyM3_1803        CDS       T00089                                 

Gene name
ruvA
Definition
(GenBank) putative Holiday junction DNA helicase
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
spg  Streptococcus pyogenes MGAS315 (serotype M3)
Pathway
spg03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:spg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SpyM3_1803 (ruvA)
Enzymes [BR:spg01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SpyM3_1803 (ruvA)
DNA repair and recombination proteins [BR:spg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SpyM3_1803 (ruvA)
    RecFOR pathway proteins
     SpyM3_1803 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N RuvA_C HHH_5 HHH HHH_3 PHA_synth_III_E
Motif
Other DBs
NCBI-ProteinID: AAM80410
UniProt: P0DF48
Position
complement(1832319..1832915)
Genome map
AA seq 198 aa AA seqDB search
MYDYIKGQLTKITAKYIVVEANGLGYMINVANPYSFTDSVNQLVTIYLHQVIREDAHLLF
GFHTEDEKDVFLKLISVSGIGPTTALAIVAVDDNEGLVNAIDNSDIKYLMKFPKIGKKTA
QQMVLDLAGKFVEAPQETGHTKARSNKAGNTQLDEAIEALLALGYKAKELKKIRAFFEGT
SETAEQYIKSALKLLMKG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtacgattatattaaaggtcaattgaccaaaattacggcaaaatacattgtcgttgaa
gctaatggattgggctacatgattaatgttgccaatccttatagctttacagatagtgtc
aaccaattggtaaccatttatctgcatcaagtgattcgtgaggatgctcacctgttgttt
ggttttcacacggaagatgaaaaagatgtttttctgaaattaatttctgtatcaggtatt
ggtccgacaacagctcttgctattgtggcagttgatgataatgagggacttgtgaatgcc
attgataacagtgacattaagtacctaatgaaatttcctaaaattggtaaaaaaacagcg
cagcaaatggttcttgacttagctggcaaatttgtggaggctccacaagagactggtcat
accaaagcgcgcagcaataaagcaggcaatactcaactggacgaagcgattgaagccctc
cttgccctcggttataaagcaaaagagctgaaaaaaattcgtgccttctttgaggggacc
tctgagacggcagagcaatacatcaaatcagcattgaaactgttaatgaaagggtag

DBGET integrated database retrieval system