KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy1345
Entry
MGAS10270_Spy1345 CDS       T00355                                 
Symbol
ssb1
Name
(GenBank) phage single-strand DNA binding protein
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
SSDB
Motif
Pfam: ERF
Other DBs
NCBI-ProteinID: ABF34410
UniProt: Q1CQ18
Position
complement(1287922..1288596)
AA seq 224 aa
MRKSESITEYAKAFCKAQLEVKQPLKDKDNPFFKSKYVPLENVTEAITKAFANNGISFSQ
DPTTNAENGYIDVATLVMHTSGEWVEYGPLSVKPTKNDVQGAGSAITYAKRYALSAIFGI
TSDQDDDGNEASKPNKTNQSQKPTNKTSKGASFQTPKISNIQVETYKSDLSDIAKATNQN
VEELTKWLTDTLKVKTLEDLRTEQIVSTDNLINKLKKKAEQKND
NT seq 675 nt   +upstreamnt  +downstreamnt
atgaggaaatcagaaagtataacagaatatgctaaagccttttgtaaagctcagctagag
gtaaagcaaccgctaaaagataaagacaacccctttttcaaaagcaaatacgtgcctcta
gaaaacgtgacggaagcgattacaaaagcctttgctaataacgggatatctttttcgcag
gatccaacaacaaacgcagaaaacggttatatcgatgttgcaacgctagtcatgcacacg
agtggcgaatgggtggaatacggacctttaagtgttaaaccaacaaaaaatgatgtacaa
ggcgctggttcggctatcacttacgcaaaacgctacgcactatcagcaatttttgggata
acaagcgatcaagatgatgacggcaatgaagctagcaaacccaacaaaacaaatcaatcg
caaaaaccaacaaataaaacgtcaaaaggggcaagcttccaaaccccgaaaatcagcaat
atccaagtagagacttataaatctgatttaagcgatattgcaaaagccacaaatcaaaat
gtcgaagagctaacaaaatggctaacagataccttaaaagttaaaacactggaagattta
cgcacagaacagattgtatcgactgataatttgattaataaattaaaaaagaaagcagag
caaaaaaatgattaa

DBGET integrated database retrieval system