KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy1356
Entry
MGAS10270_Spy1356 CDS       T00355                                 
Name
(GenBank) phage antirepressor protein
  KO
K07741  anti-repressor protein
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
Brite
KEGG Orthology (KO) [BR:sph00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    MGAS10270_Spy1356
SSDB
Motif
Pfam: ANT AntA Peptidase_C3 Bro-N
Other DBs
NCBI-ProteinID: ABF34421
UniProt: Q1CQ07
Position
complement(1291942..1292670)
AA seq 242 aa
MNNLITVTLNENQEPIVSGRDLHQALEIKTQYTKWLERMSDYGFEENEDYVAISQKRLTA
QGNQTEYTDHVLKLDMAKEIAMLQRNEKSKQVRKYFIQIEKDFNSPEKIMARALLMADKK
VHKLEAQIEADRPKVLFADAVSASKSSCLIGELAKILKQNGVNIGQNKLFQWLRANGYLI
SRRGESWNQPTQKSMQLGLFELKKTAINHSDGHTTTNVTPKVTGKGQQYFINKFFNQEYL
PV
NT seq 729 nt   +upstreamnt  +downstreamnt
atgaataatcttatcacagtaacactaaacgaaaaccaagaacctattgtttctggtcga
gatttgcatcaagcattagaaattaaaactcagtacacaaaatggttagaacgaatgtct
gattatgggtttgaagaaaatgaagactatgtagctattagtcaaaaaagactaacagct
cagggcaatcaaacagaatatacagaccacgttctaaaactagacatggctaaagaaatt
gcgatgcttcaacggaacgaaaagtctaaacaagtccgcaaatactttatccaaatcgaa
aaagacttcaacagccctgagaaaatcatggcaagggcgttactgatggcggataagaaa
gtgcataaacttgaagcacaaatcgaggcagaccgtcccaaagtactatttgctgatgct
gtaagtgctagcaaatcatcttgtctgattggtgagttagctaaaatcctgaaacagaat
ggagtcaatattggtcagaataagctatttcagtggttacgagccaacggctacctaatc
agtcgccgtggtgagtcttggaatcagccaacgcaaaaaagtatgcagcttggattgttt
gaactcaaaaaaacagccatcaatcactctgacggtcacactacaacaaatgtaacccca
aaagttactggtaaagggcaacaatactttattaataaattctttaaccaggaatatctg
ccagtttag

DBGET integrated database retrieval system