KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy0230
Entry
MGAS10270_Spy0230 CDS       T00355                                 

Gene name
rpsL
Definition
(GenBank) SSU ribosomal protein S12P
  KO
K02950  small subunit ribosomal protein S12
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
Pathway
sph03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sph00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    MGAS10270_Spy0230 (rpsL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sph03011]
    MGAS10270_Spy0230 (rpsL)
Ribosome [BR:sph03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    MGAS10270_Spy0230 (rpsL)
  Bacteria
    MGAS10270_Spy0230 (rpsL)
  Archaea
    MGAS10270_Spy0230 (rpsL)
SSDB
Motif
Pfam: Ribosom_S12_S23
Other DBs
NCBI-ProteinID: ABF33295
UniProt: Q1JIM8
Position
240709..241122
AA seq 137 aa
MPTINQLVRKPRKSKIEKSDSPALNIGYNSHKKVQTKMAAPQKRGVATRVGTMTPKKPNS
ALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGV
ADRKQGRSKYGAKRPKG
NT seq 414 nt   +upstreamnt  +downstreamnt
atgcctacaattaaccagttggtacgtaaaccacgtaaatctaaaattgaaaaatcagat
tcaccagctttgaacattggttacaacagtcacaaaaaagttcaaactaaaatggctgcc
ccacaaaaacgtggcgttgctactcgtgttggaacaatgacacctaaaaaacctaactca
gcccttcgtaaattcgctcgtgtacgtttgagcaaccttatcgaagtaactgcctacatc
ccaggtatcggacacaacttgcaagagcacagcgttgttcttatccgtggcggacgtgta
aaagaccttccaggggtacgttaccatatcgttcgtggcgcacttgatactgcaggtgtt
gctgaccgtaaacaaggccgttctaaatacggtgcgaaacgtccaaaaggataa

DBGET integrated database retrieval system