KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy0279Help
Entry
MGAS10270_Spy0279 CDS       T00355                                 

Gene name
covR
Definition
(GenBank) Response regulator CsrR
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ABF33344
UniProt: Q1JIH9
Structure
PDB: 

Position
295326..296012
Genome map
AA seq 228 aa AA seqDB search
MTKKILIIEDEKNLARFVSLELQHEGYEVIVEVNGREGLETALEKEFDLILLDLMLPEMD
GFEVTRRLQTEKTTYIMMMTARDSIMDVVAGLDRGADDYIVKPFAIEELLARIRAIFRRQ
DIESEKKVPSQGIYRDLVLNPQNRSVNRGDDEISLTKREYDLLNILMTNMNRVMTREELL
SNVWKYDEAVETNVVDVYIRYLRGKIDIPGKESYIQTVRGMGYVIREK
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagaaaattttaattattgaagatgaaaagaatctggctagattcgtttctctt
gagctgcaacatgagggttatgaagtcattgttgaggtcaatggtcgtgaagggttagaa
actgctttggaaaaagagtttgatttaatcctgcttgacttaatgttaccagagatggat
ggttttgaagtgacccgtcgtttgcaaaccgaaaaaacaacgtatatcatgatgatgact
gcgcgtgattctattatggatgtggttgcaggtttagaccgcggtgcagacgactatatt
gttaaaccgtttgccattgaagaactacttgcccgtattcgtgctattttccgccgtcaa
gatattgaatctgagaagaaagtgcctagtcaaggcatttatcgagatctagttttaaat
ccacaaaaccgttcagttaatcgtggcgacgatgagatttctctcactaaacgtgaatat
gatttgcttaatattttgatgactaatatgaatcgtgtcatgacacgtgaagaattattg
tcaaatgtttggaaatatgatgaagccgttgagactaatgttgtagatgtctatattcgt
tatctccgcggcaaaattgacattccaggcaaggaatcttatatccaaacagtgcgtggc
atgggatacgttattcgtgagaaataa

DBGET integrated database retrieval system