KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy0753
Entry
MGAS10270_Spy0753 CDS       T00355                                 

Gene name
rpiA
Definition
(GenBank) Ribose 5-phosphate isomerase
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
Pathway
sph00030  Pentose phosphate pathway
sph01100  Metabolic pathways
sph01110  Biosynthesis of secondary metabolites
sph01120  Microbial metabolism in diverse environments
sph01200  Carbon metabolism
sph01230  Biosynthesis of amino acids
Module
sph_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:sph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MGAS10270_Spy0753 (rpiA)
Enzymes [BR:sph01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     MGAS10270_Spy0753 (rpiA)
SSDB
Motif
Pfam: Rib_5-P_isom_A DeoRC CoA_trans
Other DBs
NCBI-ProteinID: ABF33818
UniProt: Q1JHB8
Position
730586..731269
AA seq 227 aa
MEALKKIAGVTAAQYVTDGMTIGLGTGSTAYYFVEEIGRRVKQEGLQVVGVTTSSVTSKQ
AEGLGIPLKSIDDIDSIDLTVDGADEVDKDFNGIKGGGAALLMEKIVATPTKEYIWVVDA
SKMVEHLGAFKLPVEVVQYGADRLFRVFEKAGYKPSFRMKGDSRLVTDMQNYIIDLDLGC
IKDPVAFGHLLDGTVGVVEHGLFNGMVDKVIVASKDGVTVLEAPKAS
NT seq 684 nt   +upstreamnt  +downstreamnt
atggaagcactcaaaaaaattgccggtgttaccgctgcgcaatatgtgactgatggcatg
accattgggcttggaactgggtcaacggcttactattttgttgaggaaattggccgtcgc
gtaaagcaagaaggactgcaagtggttggtgtgaccacgtcaagtgtgactagcaagcaa
gcagaaggcttaggcattcctttaaaatcgatagatgatattgatagcattgacctcacc
gtagatggtgctgatgaagtggataaggatttcaatggaatcaagggtggtggcgcagcc
ttactaatggaaaaaattgttgcaacaccaacaaaagaatacatctgggttgttgatgct
tctaaaatggtagagcatctgggtgcctttaagttaccagtcgaagtcgttcaatacggt
gctgatcgtttgttccgtgtctttgaaaaagctggttacaaaccgtcttttcgtatgaaa
ggtgatagtcgtttggtgacagacatgcaaaactatattattgatcttgatttgggttgt
attaaagatcctgttgcttttggtcacctgctagatgggacagttggtgttgtggaacac
ggtctctttaatggtatggttgataaggtgattgttgctagtaaagacggcgttactgtt
ttagaagcgcctaaagcaagctag

DBGET integrated database retrieval system