KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy1103Help
Entry
MGAS10270_Spy1103 CDS       T00355                                 

Gene name
pfk
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
Pathway
sph00010  Glycolysis / Gluconeogenesis
sph00030  Pentose phosphate pathway
sph00051  Fructose and mannose metabolism
sph00052  Galactose metabolism
sph00680  Methane metabolism
sph01100  Metabolic pathways
sph01110  Biosynthesis of secondary metabolites
sph01120  Microbial metabolism in diverse environments
sph01130  Biosynthesis of antibiotics
sph01200  Carbon metabolism
sph01230  Biosynthesis of amino acids
sph03018  RNA degradation
Module
sph_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sph00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MGAS10270_Spy1103 (pfk)
   00030 Pentose phosphate pathway
    MGAS10270_Spy1103 (pfk)
   00051 Fructose and mannose metabolism
    MGAS10270_Spy1103 (pfk)
   00052 Galactose metabolism
    MGAS10270_Spy1103 (pfk)
  Energy metabolism
   00680 Methane metabolism
    MGAS10270_Spy1103 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MGAS10270_Spy1103 (pfk)
Enzymes [BR:sph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MGAS10270_Spy1103 (pfk)
Protein phosphatases and associated proteins [BR:sph01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MGAS10270_Spy1103 (pfk)
Messenger RNA biogenesis [BR:sph03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     MGAS10270_Spy1103 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ABF34168
UniProt: Q1JGH6
Position
complement(1051257..1052270)
Genome map
AA seq 337 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGINRGYAGMVDGDIFPLGSKEVGDK
ISRGGTFLYSARYPEFAQLEGQLAGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GIPGTIDNDIAGTDYTIGFDTAVNTAVEAIDKLRDTSSSHGRTFVVEVMGRNAGDIALWA
GIASGADQIIVPEEEFDIEKVASTIQYDFEHKGKNHHIIVLAEGVMSGEAFAQKLKEAGD
KSDLRVTNLGHILRGGSPTARDRVIASWMGSHAVELLKEGKGGLAVGIHNEELVESPILG
TAEEGALFSLTEEGKIIVNNPHKARLDFAALNRSLSQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttaaccagtggcggcgacgctcctggtatgaatgctgctatt
cgtgcagtcgttcgtaaagcaatttcagaaggaatggaagtttatggtatcaaccgtggc
tatgcaggtatggttgatggcgacattttcccactgggttcaaaagaagttggtgataaa
atctcacgtggtggaactttcttatactcagctcgttatccagaatttgctcaacttgaa
ggtcaattggctggtattgagcaacttaaaaaacatggtattgagggtgttgttgttatt
ggtggggatggttcttatcatggcgctatgcgcttgacagagcacggcttcccagcggta
ggtatcccaggaacaatcgataacgatattgcgggaactgactacactatcggatttgat
acagcagttaacacagcagttgaagctattgataaacttcgtgacacctcatcaagtcac
ggacgtacttttgtggttgaagtgatgggtcgcaatgcgggtgatattgctctttgggca
ggtattgctagtggtgctgatcaaatcattgttccagaagaagagtttgatattgaaaaa
gtggcatcaacaatccaatatgattttgaacacaaaggtaaaaatcaccacattatcgtc
ttagctgaaggtgttatgagcggtgaagcttttgctcaaaaactgaaagaagctggcgat
aagagtgaccttcgtgtgacaaatcttggtcacattcttcgtgggggttcaccaactgct
cgtgaccgtgtcattgcttcttggatgggttcacatgctgttgagctacttaaagaaggc
aaaggtggtttggctgttggtattcacaatgaagaacttgttgaaagcccaatccttggt
actgcagaagaaggtgctttgttcagcttgactgaagaaggcaagattattgttaataat
ccacacaaagctcgtttagactttgcagctttgaatcgttcattgtcacaataa

DBGET integrated database retrieval system