KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy1273Help
Entry
MGAS10270_Spy1273 CDS       T00355                                 

Gene name
glcK
Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
Pathway
sph00010  Glycolysis / Gluconeogenesis
sph00052  Galactose metabolism
sph00500  Starch and sucrose metabolism
sph00520  Amino sugar and nucleotide sugar metabolism
sph00521  Streptomycin biosynthesis
sph01100  Metabolic pathways
sph01110  Biosynthesis of secondary metabolites
sph01120  Microbial metabolism in diverse environments
sph01130  Biosynthesis of antibiotics
sph01200  Carbon metabolism
Module
sph_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sph_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sph00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MGAS10270_Spy1273 (glcK)
   00052 Galactose metabolism
    MGAS10270_Spy1273 (glcK)
   00500 Starch and sucrose metabolism
    MGAS10270_Spy1273 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    MGAS10270_Spy1273 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MGAS10270_Spy1273 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    MGAS10270_Spy1273 (glcK)
Enzymes [BR:sph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MGAS10270_Spy1273 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: ABF34338
UniProt: Q1JG06
Position
complement(1231755..1232726)
Genome map
AA seq 323 aa AA seqDB search
MSQKLLGIDLGGTTIKFGILTAAGEVQEKWAIETNILEGGKHIVPDIIASIKHRLDLYGL
SSADFVGIGMGSPGAVDRDTNTVTGAFNLNWKETQEVGSVVEKELGIPFAIDNDANVAAL
GERWVGAGENNPDVVFMTLGTGVGGGIIADGNLIHGVAGAGGEIGHMIVEPENGFACTCG
SHGCLETVASATGVVKVARLLAEAYEGDSAIKAAIDNGEGVTSKDIFMAAEAGDSFADSV
VEKVGYYLGLASANISNILNPDSVVIGGGVSAAGEFLRSRIEKYFVTFTFPQVRYSTKIK
IAELGNDAGIIGAASLARQFITK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaaattactggggattgatttaggtggtaccaccattaaatttggaatttta
acagcagcaggagaagtccaagaaaaatgggcaattgagactaatattttagaaggaggc
aaacatattgtccctgatatcatcgcttccatcaaacatcgcttagacttgtatggtcta
agcagtgctgattttgtgggaattggtatgggatcaccaggagcggttgaccgtgatact
aatacagttactggggcattcaaccttaattggaaagaaacccaagaagtcggttccgtt
gttgaaaaagaattgggcattccttttgccattgacaatgatgccaatgtggctgccctt
ggtgaacgttgggtaggtgctggtgaaaataacccagatgtcgtcttcatgacacttgga
acaggtgtcggtggaggcattattgctgatggtaacttgattcatggtgttgcaggagca
ggtggtgaaatcggccacatgattgttgagccagaaaatggctttgcttgtacttgtggc
tcacacggctgtttggaaacagtagcttcagcaacaggagttgtcaaagtggcacgttta
ttggcagaagcttatgaaggggattcagccatcaaagcagctattgacaatggtgaaggt
gttaccagcaaagatatttttatggcggctgaagcaggggattcctttgctgattctgtt
gtggaaaaggttggttactaccttggccttgcttcagcaaatatttccaatatcttgaat
ccagactcagtggttatcggtgggggtgtgtcggcagcaggagaatttctacgctcacgt
attgaaaaatactttgtgaccttcactttcccacaagtgaggtattcaactaaaattaag
attgcagagcttggcaatgatgctggaattatcggtgcagctagccttgctcgacaattt
atcacaaaatag

DBGET integrated database retrieval system