KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy1378Help
Entry
MGAS10270_Spy1378 CDS       T00355                                 

Gene name
int3
Definition
(GenBank) DNA integration/recombination/inversion protein
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_integrase AbiGii_2 Arm-DNA-bind_4 ART
Motif
Other DBs
NCBI-ProteinID: ABF34443
UniProt: Q1JFW6
Position
complement(1312338..1313474)
Genome map
AA seq 378 aa AA seqDB search
MATYRQRGKKKLWDYRVYGKDGKLIASGSGFRTKKEASYEALKIEQKKYYSDVINSNATL
FEMWQIWYDLVVEPSELDILTKQKYQARGKIIEKYLSDIPANRIKHSKYQEFIKFYGKNV
TLNLMTCLNSDIRKVIIFFKRDGVLIEDFTEGVKIFGKPYRKSPEDKYLKSIEDYQKLLA
YLKRIANYSDSIIPFFLFTMLQTGFRFGEAMAITWDDIDFERNSIYTYRRYSSIKKDFTK
PKTRTSIRRVPVSHDLKELLLELKFQQERMLRGLHIKNTDQLIFYDYRFGMISNNAVNKF
LASSLEKLEIESKMSSTGARHTYGSYLLANGVDIWAVAKLMGHKDIKQLIETYGHLLLEV
EEKENDQLLKILNNKGSF
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggcaacatatagacaaagaggtaaaaagaaattatgggattatcgtgtttatggtaaa
gatggaaaattaatagcatctggttcaggctttagaacaaaaaaagaagcatcatatgaa
gctttaaaaattgagcaaaaaaaatattattcagatgttataaattccaatgctacatta
tttgagatgtggcaaatatggtatgatcttgttgttgagccaagtgaattagatattctt
actaagcaaaaatatcaagcccgaggaaagataattgaaaaatatttatctgatatccct
gctaatagaattaaacatagtaagtatcaagaatttattaagttttatggtaaaaatgta
actttgaatttaatgacttgtttgaattcagatattagaaaggttataattttttttaaa
agggacggagttttaattgaagattttacagaaggagttaaaatttttggaaaaccatat
aggaagtcgccagaggataagtatttaaaaagtattgaagattatcaaaaattattagca
tatttaaaaagaatagctaattattcagactcaataatccctttttttcttttcacaatg
ttacaaactggttttaggtttggtgaagcaatggcaataacttgggatgatattgatttt
gaaagaaatagtatttatacatatcgaagatattcttcaataaaaaaggactttacaaag
cctaaaacaaggacttcaataaggagagttccagtaagtcatgatttaaaagagttattg
cttgaactaaaatttcaacaagaaagaatgctgagaggtttgcatataaaaaatacagat
caattgattttttatgactataggtttggtatgatatcaaataatgctgttaacaaattc
ttggcaagctcattggaaaaattagaaatagaatctaagatgtcatcaacaggtgctaga
catacttatggaagttatttgttggctaacggagtagatatttgggcggttgcaaaatta
atggggcataaagatatcaaacaattaatagaaacatatggtcatttgcttctggaggtg
gaagaaaaggaaaatgatcagcttttaaaaattcttaataataaaggtagtttttaa

DBGET integrated database retrieval system