KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy1379Help
Entry
MGAS10270_Spy1379 CDS       T00355                                 

Definition
(GenBank) hypothetical protein
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF771
Motif
Other DBs
NCBI-ProteinID: ABF34444
UniProt: Q1JFW5
Position
complement(1313524..1313856)
Genome map
AA seq 110 aa AA seqDB search
MSMQQVFNVSVPVPDDVVIISKEEYLDLLSDNEQGKWWDIDNLQELLGLGRSKLINDILL
NPDIKKEVDLSINPNGFIVYPRGKGSRYKILATRARKYFEENFGSILLNN
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgagtatgcaacaagtttttaatgtgagtgttcctgtaccagatgatgttgttatcatt
tctaaagaggaatatttagatttgttaagtgataatgaacaaggaaaatggtgggatatt
gataatttgcaagaattgttgggccttggtaggtcaaagttaattaatgatatcttatta
aacccagatattaaaaaggaagttgatttatcaatcaatccaaatggttttattgtttat
cctagggggaaaggtagccgttataaaatattagcaactagagctagaaaatactttgaa
gaaaattttggttctattttattaaataactaa

DBGET integrated database retrieval system