KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy1380Help
Entry
MGAS10270_Spy1380 CDS       T00355                                 

Definition
(GenBank) hypothetical membrane spanning protein
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S3Ae
Motif
Other DBs
NCBI-ProteinID: ABF34445
UniProt: Q1JFW4
Position
complement(1314023..1314565)
Genome map
AA seq 180 aa AA seqDB search
MLNYKYITLNDSYELNVWLDFVLRDLKKEEKYSKFRFIIKKLSIKNSRTTFQEIESVRKE
LMGLSELDLKHLRMIIENRETTGIGLEFKAFLQKIFNYFGVIVVGLIPVILGYNSIERVV
TSWLNAKTFKSSILLIVWIFVLYIYYVVFKEFFLHDSKKREVRKYLLFLINDILLDMEKR
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
gtgttgaactataagtatattactctaaatgatagttatgagttaaatgtttggttagat
tttgtattacgtgatttaaaaaaggaagaaaagtattctaaatttagatttataataaaa
aaattgtctattaaaaattcaagaactacatttcaagaaatcgaaagtgttcgtaaagaa
ttaatgggactatcagaacttgatttgaagcatttaagaatgataattgaaaatagagag
acaacagggattggtttagaattcaaagcatttttacaaaagatatttaattattttggt
gtgattgtagtaggtttaattccagtaatattaggttataattcaatagagagagttgta
acttcttggttaaatgccaaaacttttaaatctagtattttattaattgtatggatattt
gttttatatatttattatgtagtttttaaagaattctttttgcatgattctaaaaaaaga
gaagttagaaagtatttgttatttttgataaatgatattttattagatatggagaaacgt
tga

DBGET integrated database retrieval system