KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy1382Help
Entry
MGAS10270_Spy1382 CDS       T00355                                 

Definition
(GenBank) hypothetical exported protein
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABF34447
UniProt: Q1JFW2
Position
complement(1315574..1316131)
Genome map
AA seq 185 aa AA seqDB search
MKIRKVIIVMLAVALSLGFYRLYHRQKPSQLIEANQEILVKPITPNKSKIKVKRNVAKEA
KATLEMPEERVNEKEAKQVKSAIVIPIDYLASISSQDDIKVTYDNKLSITNPAMAASIKT
MLLAGYHFDLDSLTVYQSNSDNVYQFTILLVTHQQDQLSLVGNYVTGTGQFEFVSLHGTP
KNVMF
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaagataagaaaagttattattgttatgctggcagtagctctttcattaggattttat
cggttgtatcatcgtcaaaagccatctcagttaatagaagctaatcaagaaatacttgta
aaaccaattacaccgaataaaagtaaaattaaggttaagagaaatgttgccaaagaagcc
aaggccactttagagatgcctgaggagcgtgttaacgaaaaagaagctaaacaggtgaaa
tcagctattgtaataccgattgattatttagctagtatatcaagtcaagatgatattaag
gttacttatgataataagttgtccattactaatccagcaatggcagcaagcattaaaacg
atgcttttagcagggtatcactttgatttagatagcttgacggtttatcagagcaattct
gataatgtgtatcaatttacgattttattagtgactcatcagcaagatcaattaagtctt
gttggtaattatgttactggtacgggtcagtttgaatttgtgagtttacatggcactcca
aaaaatgtcatgttttaa

DBGET integrated database retrieval system