KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy1388Help
Entry
MGAS10270_Spy1388 CDS       T00355                                 

Definition
(GenBank) hypothetical membrane spanning protein
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABF34453
UniProt: Q1JFV6
Position
complement(1323200..1323469)
Genome map
AA seq 89 aa AA seqDB search
MKVSKVAQVVLTGGGPNVSGLKQFFQGDGIYLISVICAFLVIKNWKNADWLKVGSVLSIY
AIVVSLFKGQEILAFLGGMLRWFGIETGL
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtatcaaaagtagctcaagttgttttaacaggaggaggacctaatgtttcagga
ctaaaacaattttttcagggagatgggatttatcttattagtgttatctgtgctttttta
gtgattaaaaattggaaaaatgcagattggctaaaagttggctcagtactgtcaatttat
gcgattgtggtttctctgtttaaagggcaagaaattcttgcctttttaggagggatgctt
cgctggttcggtattgagacaggtttataa

DBGET integrated database retrieval system