KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy1390Help
Entry
MGAS10270_Spy1390 CDS       T00355                                 

Definition
(GenBank) hypothetical protein
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABF34455
UniProt: Q1JFV4
Position
complement(1324439..1324918)
Genome map
AA seq 159 aa AA seqDB search
MIAIIRTHEKGRSQFLCELDIMQFTENQVRDHMIERGIKDDAFFICGFSDWNIDRIMSLS
EVYLLKRCIVGLYDGDDYIVQYLLKKGLSVPAIVTKFYVFLSKDEKEAMGYVLKNVSFDS
LIDFWQRSVTWANALNAYIQSGILLNTSKGFYVLKTEGG
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgattgcaattataagaactcatgaaaaaggtagaagtcaatttttatgtgagttagac
atcatgcagtttacggaaaatcaagtaagagatcacatgatagaaagaggtatcaaggat
gatgcctttttcatttgtggtttttctgattggaatattgataggattatgtcactttcg
gaagtttaccttttaaagagatgtattgttggtctttatgatggcgatgattacattgtt
caatatttgttaaagaaaggcttgtcagtgccagccatagtgacaaagttttatgtcttt
ttgtcaaaagatgaaaaagaagcaatgggatatgttttgaaaaatgtatcatttgattca
ttgattgatttttggcaacggtcagtaacttgggcaaatgctttaaacgcttacatacaa
agtggaatattgttaaatacatccaaaggattttatgtgttaaaaacagaaggaggttag

DBGET integrated database retrieval system