KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy1391Help
Entry
MGAS10270_Spy1391 CDS       T00355                                 

Definition
(GenBank) hypothetical protein
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArdA
Motif
Other DBs
NCBI-ProteinID: ABF34456
UniProt: Q1JFV3
Position
complement(1324926..1325177)
Genome map
AA seq 83 aa AA seqDB search
MHQVTGYTASDFVDYDFNFGDCCLLPDVTTRRELGEYWFNELGSEGVGKENMELYFDCEA
YGRDIDLESQGGFSDYGYVEISG
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
gtgcatcaggtaacaggttatactgcctcagactttgtagattatgattttaattttggt
gattgttgtttactgcctgatgtcacaactagacgagaattaggcgaatactggtttaat
gaattaggttcagaaggtgttggtaaagaaaatatggaactctattttgattgtgaagct
tatggtcgagatattgacttagaaagccaaggtggtttttcagactacggatatgtcgaa
atatcagggtaa

DBGET integrated database retrieval system