KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy1392Help
Entry
MGAS10270_Spy1392 CDS       T00355                                 

Definition
(GenBank) hypothetical protein
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABF34457
UniProt: Q1JFV2
Position
complement(1325207..1325416)
Genome map
AA seq 69 aa AA seqDB search
MSKMDVSAIVRDIKTGRATLVCFPVEMSELKLALGLREEDDLEYIIADSDCQLLKEHDSI
EMINNLLNW
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaaaatggatgttagtgcaattgttagagatataaaaactggtagagctacgtta
gtttgttttcctgtggaaatgagtgagcttaagttagctttggggcttcgtgaagaagat
gatttagagtatattattgcagattcggattgtcagttactaaaagaacatgattctatt
gagatgattaataatttgttgaactggtag

DBGET integrated database retrieval system