KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy1393Help
Entry
MGAS10270_Spy1393 CDS       T00355                                 

Definition
(GenBank) hypothetical protein
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FANCI_HD2
Motif
Other DBs
NCBI-ProteinID: ABF34458
UniProt: Q1JFV1
Position
complement(1325460..1325732)
Genome map
AA seq 90 aa AA seqDB search
MSNTRSEADKKLLVVTQELSELLISHQYDQSWEKAGELNSLLKKREELTLPGYMVDMIQQ
HLKSYYYQNNMINKAHKSMSAIGHKLQEFH
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatacacgttcagaagcagataaaaagttgttagtggttactcaggagctatca
gaactgctgattagtcatcagtatgaccagtcatgggaaaaagctggagagttaaatagc
ttacttaaaaaacgtgaagaattgaccttaccaggttatatggtcgacatgattcaacaa
catttgaaatcatactactaccaaaataatatgattaataaggctcataagtctatgtca
gcgattggtcataaactacaagaatttcattaa

DBGET integrated database retrieval system