KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy1395Help
Entry
MGAS10270_Spy1395 CDS       T00355                                 

Definition
(GenBank) Transcriptional regulator, Cro/CI family
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rep_trans Rol_Rep_N HTH_3 HTH_19 HTH_31 MqsA_antitoxin HTH_26 HTH_37
Motif
Other DBs
NCBI-ProteinID: ABF34460
UniProt: Q1JFU9
Position
complement(1326499..1327740)
Genome map
AA seq 413 aa AA seqDB search
MNPMYLKKFRKKSGLKQKEFAKCIGISQAMLSQYESGKKKLSLEKFQEMKTHFGYLTDND
SSRLQVTIDYVRITLKSVRDLEFFCRNFLHCRFKEFSSVESKLMNYNHIWKRGDIWIFDY
ADKHDTGNYQITLQLSGQGCRQLELLMEQENFAWLDWLIYLRRSYRDEMNVTRFDLAIDE
LYLGKDRENEHFLLSDMIVKYYHHELAFESLRTWNYIGGGALNFNDMEEIEQNRQGISLY
FGSRQSEMYFNFYEKRYELAKLEGISVEESLEIFEIWNRYEIRLSQSKANAVVDEFISGI
PLGEIARGLINSKIQVYDGKNKYGAFMADQKWQMMFGGVEPLTFVTRPESYNIERTIRWL
IHQVSDSLAMVSEYDSMIDGDNLQMIINSGEVNERGEKILETIRYNLGLDKGA
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaatccaatgtatttaaagaaatttaggaagaaatcaggcttaaagcagaaagaattt
gcaaaatgtataggtattagtcaagctatgttatctcaatatgaatctggtaagaaaaaa
ttatctcttgaaaaatttcaagaaatgaaaacacattttggttatttgactgataatgat
agttcaagattacaagtgacaattgactatgtcaggattacgttaaaaagcgttagagat
ttggaatttttttgtcggaattttttacattgtcgatttaaagaattttcatcagttgaa
tctaagttgatgaattataaccatatttggaaacgtggagatatttggatatttgattat
gcagataaacatgatacaggaaactatcaaataacattacagctatctggtcaaggatgt
agacaattagaattacttatggaacaagaaaattttgcttggttagattggctaatctac
ttaagacgttcttatcgagatgaaatgaatgttacacgttttgacttagctattgatgaa
ttgtatctgggtaaggatagagaaaatgaacactttcttttatcggatatgattgtcaaa
tattatcatcatgagttagcttttgaaagtttgcgaacatggaattatattggtggtggt
gctttaaattttaatgatatggaagaaattgaacagaatcgtcaaggtatttcgttatat
tttggtagtcgacagtctgaaatgtattttaacttttatgagaaaaggtatgaattagct
aaattagagggcatctctgttgaagaatctttagaaatatttgaaatatggaatcggtat
gaaatccgattatctcaatctaaggcgaatgcagtggtagatgaatttatttctggtatt
ccattaggagaaattgcgagaggattgattaatagtaaaattcaagtttatgatggaaaa
aataagtatggtgcatttatggctgatcaaaagtggcagatgatgtttggaggtgttgaa
cctctaacatttgtcacgagaccagaatcttataatattgaacgtactattcgctggttg
attcatcaagtatctgattctctagctatggttagtgaatatgacagtatgattgatggg
gataatctacaaatgatcattaattctggtgaagtgaatgaacgaggtgaaaaaatatta
gaaactattcgatataatctaggtttagataagggggcgtag

DBGET integrated database retrieval system