KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy1396Help
Entry
MGAS10270_Spy1396 CDS       T00355                                 

Definition
(GenBank) FtsK/SpoIIIE family
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsK_SpoIIIE DUF853 T2SSE AAA_19
Motif
Other DBs
NCBI-ProteinID: ABF34461
UniProt: Q1JFU8
Position
complement(1328052..1329761)
Genome map
AA seq 569 aa AA seqDB search
MRLLPEYRGIKVKPYMRYMSYYLFSFLFILFLIPVGVYSYYHLDLLKMMDKMTMIILGIS
LFLSLFVSWYLTWFLQEANPLFNKLDRLKRLAKFLFENGFVYEKRKKVNKKQKVSFPKVY
LKQGKFDLSVSFEMAGNKFQKRFKDIGGELEDTFFMDFMEKTDDPRFKIYKLAYSAFLAR
ITVNDVVWEKDKGIKLMNGYYWDFINDPHLLVAGGTGGGKTVLLRSILKCLATIGVADIC
DPKRADFVTMADLPAFRGRIVFEKVDIIAKFENAITIMYARYDFIRKEMKRLGHKDMGKF
YDYGLEPYFFICDEYNALMSSLSYQERDIVENAFTQYILLGRQVGCNAIIAMQKPSADDL
PTKIRSNMMHHISVGRLDDGGYMMLFGDENRNKEFRYIKFLSGHRVYGRGYSAVFGEVAR
EFYAPLLTKKFSFYDEFAKISRHDNPFDPLENTLVSKDIISDESLRKFVEKTSDNELPKG
SIGFDFEEEMEEINHMSIGDLAKKTGFSFGKIKNLIDMIEKDGYMTFNREDERVVLTDSD
AVILNSLLTQKDKFDGSWKELLLNYFKGE
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttactgcctgaatatagagggattaaggtaaaaccatatatgaggtatatgagt
tattaccttttttcttttctatttattttgtttttgatacctgtaggggtttatagttac
taccatttagatttgttaaaaatgatggataaaatgactatgataattttagggataagt
ttgtttttatcgctttttgtttcttggtatttgacttggtttttacaagaagctaatcca
ttatttaataagttagatcgtttaaagcgtttggctaaatttttatttgaaaatggtttt
gtttatgaaaaacgtaaaaaagttaataagaagcagaaagttagttttccaaaagtttat
ttaaaacaaggtaagtttgatttaagtgtctcctttgaaatggcaggaaacaaatttcaa
aagcgtttcaaagatattggaggtgaacttgaagatactttttttatggattttatggaa
aaaactgatgatcctaggtttaagatttataaattagcttattccgcctttctggctcgt
ataacggttaatgatgttgtatgggaaaaggataaaggcattaagctgatgaatggttat
tattgggattttatcaatgatcctcatttgcttgttgcgggtgggactggtggcggtaag
actgttttgcttagatcaattttaaaatgtcttgcaactattggcgttgcggatatatgt
gatcctaagcgagctgattttgtgacaatggctgatttacctgcttttcgaggaagaatt
gtttttgaaaaagtagatattattgctaaatttgagaatgcaattacaatcatgtatgca
cgctatgactttattcgtaaggaaatgaaacgtttagggcataaagatatggggaaattt
tatgattacggattagaaccatatttttttatttgtgatgaatataatgccttgatgtct
tcgttatcgtatcaggaaagagacattgttgagaatgcctttacacagtatattctactt
ggccgtcaagtaggctgtaatgcgattattgccatgcaaaagccatccgcagatgattta
ccaacaaaaatcaggtcaaatatgatgcaccatatttctgttggtcgccttgatgatggt
ggttatatgatgctttttggggatgaaaatcggaataaagagttcaggtatattaaattt
ctatcaggtcaccgtgtgtatggtcgtggctattctgctgtttttggcgaggtagcgaga
gagttttatgctcctttgctaactaagaaattttcattttatgatgaatttgcgaaaatc
tcacgtcatgataatccatttgatccgcttgaaaatactttggtttccaaggatattatt
tcagatgaatcattgagaaaatttgtagaaaaaacgtctgacaatgagttacctaaagga
agtattggctttgattttgaagaggaaatggaggaaattaatcatatgagtattggtgat
ttagctaagaaaacaggtttttcatttggtaaaataaaaaatttaattgatatgattgaa
aaagatggttacatgacttttaatcgtgaagatgaaagagtagtattgactgattctgat
gcagttatattgaatagtttactcactcaaaaagataagtttgatggcagttggaaagag
ttgttgttgaattattttaagggtgaatag

DBGET integrated database retrieval system