KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy1399Help
Entry
MGAS10270_Spy1399 CDS       T00355                                 

Definition
(GenBank) Cell surface protein
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BspA_v Antigen_C AgI_II_C2 Gram_pos_anchor
Motif
Other DBs
NCBI-ProteinID: ABF34464
UniProt: Q1JFU5
Structure
PDB: 

Position
complement(1330806..1334864)
Genome map
AA seq 1352 aa AA seqDB search
MKQMETKGYGYFRKTKAYGLVCGITLAGALTLGTTSVSADDVTTLNPATNLTTLQTPPTA
DQTQLAHQAGQQSGELVSEVSNTEWDNAVTTAQKAGVTVKQSEKVTHDSLSSAQADLEKQ
TQAVTEATTKQEANTTAINQAVSENKAIDQANRDEKARVDALNTKGEADTKAKNETGQAQ
VDAQNKQAQAAADAMNAKLKADYEAKLTEIKQIESENEAIRQRNQQASQATHQANQAAQA
AYQEKLAEIERIKAENAAIRDRNAKAQQEAERQNQALQAAYEAKLAEIKQIESENAAIRQ
RNEQAGQATNQTNQAAQAAYQEKLAEIERIKAGNAAIRDRNAKAQQEAERQNQALQAAYE
AKLAEIKQIESENAAIRKRNEQAGQTTNQTNQAAQAAYQEKLAEIERINAENAAIRDRNT
KARQEAERQNQQLKTTYEAQLSAYQQALQAKKEAENKAIDQVVFGIDAKANGVDNAEYGN
SIMTVTTQPDGSFVFKHDMIDGVKTIGHGTLTGKINHHYEANKDGSITAYIDSVTFDKYE
YQNVAKNDAVDKNIAFRILSATGQELFVKAHDGDKTFSETLNKTVSLKLTYQLKPHEAVK
DIKVFQLHDDWVHDTHGSALVSYVNNNDAVPHIEVPEKPVEPDMVTPKVEQEKPVPEAPQ
KPTDGVPNLEKEKPVPPTPVKPEAVKPVLEQEKPVPEAPQKPTDDVPNLEKEKPVPPTPV
KPEAVKPVLEQEKPVPEAPQKPTDDVPNLEKEKPVPPTPVEPEAIKPDLQSFTPEVYDPI
KPVVKPHVTVPEKVVYEVMVHPVQVKQTPTNVKSVTNSDQVNIDGQLVPKGSTVTWELVN
TSLKAGRQDITSYELTDPLPDGFELDVTATQTLSPEWVITTDEAGKVSLKASQSLLAHFN
AKRDQDVEVPKVSLVGRLLNDAGTYHNTFKTVVTTPTGSYTVISNTPVIYTPGNDPKTPR
NPGGDNPTPHDNLIQPTKTIVDDKGQSIDGKSVLPNSTLTYVAKQDFDQYKGMTAAKESV
MKGFIYVDDYKDEAIDGHSLVVNSIKAANGDDVTNLLEMRHVLSQDTLDDKLKALIKASG
ISPVGEFYMWVAKDPAAFYKAYVQKGLDITYNLSFKLKQDFKKGDITNQTYQIDFGNGYY
GNIVVNHLSELTVHKDVFDKEGGQSINAGTVKVGDEVTYRLEGWVVPTNRGYDLTEYKFV
DQLQHTHDLYQKDKVLATVDITLSDGSVITKGTDLAKYTETVYNKETGHYELAFKQDFLA
KVVRSSEFGADAFVVVKRIKAGDVANEYTLYVNGNPVKSNKVTTHTPEQPQPVTPKAPAL
PSTGEQGVSILTALGAALLSLLGYVGLKKRQQ
NT seq 4059 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaatggaaactaagggttatggttattttagaaaaacaaaggcctatggtctt
gtttgtggtattactttagcgggagcgttgacgttgggtacaacaagtgtttctgcggat
gacgtaactactttaaacccagcgactaacttaacaacgctacaaacacctccaacagct
gatcaaacacagctagctcatcaagctggccagcagtcaggggagttggtatcagaggtg
agcaataccgaatgggataatgctgtcacaacagctcaaaaagcaggtgttactgtcaaa
cagtctgagaaggtcacacatgatagcttatcatctgcgcaagccgatttagagaaacaa
actcaagctgtcacagaagcgacaactaaacaagaagccaacacaacagctattaatcaa
gcagtttcggaaaataaagcgattgatcaagctaatcgtgatgaaaaagctagagttgac
gctcttaatactaaaggggaagctgataccaaagctaaaaatgaaactggtcaagcccaa
gtagatgcacaaaataaacaagcccaagcagcagctgatgccatgaatgccaaattaaag
gcagactatgaggccaagttaacagaaatcaagcagattgaatcagaaaatgaagctatc
cgtcagcgcaaccaacaagctagtcaagcgactcatcaagccaatcaagcagcccaagct
gcctatcaagaaaagctagcagagattgagcgcatcaaagccgaaaatgctgccattcgc
gatcgtaatgctaaggctcaacaagaagcagagcgtcaaaaccaagcgctccaagcagct
tatgaagcaaaattggcagaaatcaagcagattgaatcagagaatgctgctatccgtcag
cgtaatgaacaagcaggtcaagcgacgaatcaaaccaatcaagcagctcaagctgcctat
caagaaaagctagcagagattgagcgcattaaagctggaaatgctgccattcgcgatcgt
aatgctaaggctcaacaagaagcagagcgtcaaaaccaagcgctccaagcagcttatgaa
gcaaaattggcagaaatcaagcagattgaatcagagaatgctgctattcgtaagcgtaat
gaacaagcaggtcaaacgacgaatcaaacgaatcaagcggctcaagctgcctatcaagaa
aagctagcagagattgagcgtattaacgccgagaatgccgccattcgtgatcgcaacact
aaagctcgacaagaagcagaacgtcaaaaccaacagttaaaaactacttatgaagctcaa
ttatcagcctaccaacaagcactacaagctaaaaaagaagctgaaaacaaagctatcgat
caggttgtctttggaattgatgcaaaagccaacggtgttgataatgcagaatatggtaat
tcaatcatgactgttacaacgcaaccagatggttcgtttgtttttaagcatgatatgatt
gatggtgtcaaaacaattggtcatgggactttaacgggtaaaattaatcatcattatgag
gctaataaagatggtagcattacagcttatattgatagtgtaacatttgataagtatgaa
tatcaaaatgtagctaaaaatgacgcagttgataaaaatattgcttttcgtattttaagt
gccacaggtcaagaattatttgttaaagcccatgatggtgataaaacttttagtgaaact
ttaaataagacagtgtctcttaagttaacttaccaactaaaaccgcatgaagctgtaaaa
gatatcaaagtatttcaactgcatgatgactgggtacacgacacacatggttctgcttta
gtttcttatgtgaacaacaatgatgctgtgccacatattgaagtaccagaaaagccagtg
gagcctgatatggttacaccaaaagttgagcaagaaaaaccagtcccagaggctcctcaa
aaaccaacagatggtgttccaaacttagagaaggaaaagccggttcctccaaccccagtt
aaaccagaggcagttaaacctgttttagaacaagaaaaaccagtaccagaggctcctcaa
aagccaacagatgatgttccaaacttagagaaggaaaagccggtaccaccaactccagtt
aaaccagaggcagttaaacctgttttagaacaagaaaaaccagtcccagaagctcctcaa
aagccaacagatgatgttccaaacttagagaaggaaaaaccagtaccaccaaccccagtt
gaacctgaagcaattaagccagatctccaaagctttacgccagaggtttatgacccgatt
aaaccagttgtgaaaccccatgtcaccgttcctgaaaaggtcgtctatgaggttatggtt
catcctgttcaagtgaaacaaacgccaacaaatgttaagtctgttactaatagtgatcag
gttaatatcgatggacaactggtaccaaaaggatcaacggtaacgtgggagcttgttaat
acttctctcaaagctggtcgtcaggacatcacaagctatgaactaactgatccactacca
gatggttttgagttagatgttaccgccacacaaaccctttctcctgaatgggtgataaca
acggatgaagcaggcaaggttagtcttaaggcttctcaatcccttttggctcacttcaat
gctaaacgtgatcaagatgtagaagtccctaaggtatcactggttggtcgtttactgaat
gatgcggggacttatcacaatacctttaagacggtggtcactactccaactggtagctac
acggtaatctctaacacaccagtgatctatacaccagggaacgatccgaaaacacctcgt
aacccaggaggagataatccaacaccgcatgataatctgattcagccaactaaaaccatt
gtggacgacaagggtcagtccattgatgggaagtctgtcttgccaaacagcacgctgact
tacgtggctaagcaagattttgatcagtacaaagggatgacagctgccaaagaaagtgtc
atgaaaggctttatctatgtcgatgattacaaggatgaagcgatagatggtcattcactc
gttgtgaattccattaaggccgctaacggagatgatgtaaccaatctcttagagatgcgc
catgtgttatctcaagatacgcttgacgataagctaaaagcactcatcaaggcatcaggc
atttctccagtcggtgaattttacatgtgggtagctaaagacccagcagccttttacaaa
gcttatgttcaaaaagggttagacattacctacaacttgtcctttaaacttaaacaggac
tttaagaaaggtgacattactaaccaaacctaccaaattgattttggaaacggatactac
ggtaatatcgtggtaaaccatctgtctgaactaactgttcataaggatgttttcgataaa
gaaggtggtcaatcaatcaatgctggcactgttaaagttggtgatgaggtcacctatcgc
ttggaaggttgggttgttccgactaaccgtggctatgacttgacagaatacaaatttgtg
gatcagcttcagcatacgcatgacctctaccagaaagacaaggtccttgcgacggttgat
attactttatcagatggtagtgttatcactaaaggtactgacttagcgaaatatactgag
acagtttacaataaggaaacaggtcactatgaattagcgttcaagcaagacttcttagct
aaggtcgttcgttctagcgaatttggtgcagatgcttttgtggttgttaaacgcatcaaa
gcaggtgatgtggcaaatgagtataccttgtatgtcaacggtaatcctgtgaagtctaat
aaagtcaccactcatacgccagaacaacctcaacctgtaactcctaaagcaccagcttta
ccatccacaggagagcaaggagtatctatcttaacggcgcttggggccgctttactctca
ctcttaggttatgtagggcttaaaaagcgtcaacagtaa

DBGET integrated database retrieval system