KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy1401Help
Entry
MGAS10270_Spy1401 CDS       T00355                                 

Definition
(GenBank) hypothetical cytosolic protein
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABF34466
UniProt: Q1JFU3
Position
complement(1337367..1337759)
Genome map
AA seq 130 aa AA seqDB search
MLNNLFIEKKGIMMSRKGVQEYDVTNVSERSIKIIKKAMYDEGTGFKPIHFYGIAICEGT
REFYRPTYPFVRSEEDLDNLKDFINLYETDLLTFYTHGHNYDFGCFIYGIGNDGKDKFRD
RWFKEGVIFY
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgcttaataatttatttatagaaaagaaaggtattatgatgtctaggaaaggagtacaa
gaatacgatgtaacaaatgtatctgaaagaagtataaagataattaagaaagctatgtat
gatgaaggaacaggttttaagccaattcatttttatggaatagctatctgcgaagggact
agagaattttatagacctacttatccatttgttagaagtgaagaagatttagataactta
aaagattttattaacttatatgagacagatttgttaactttttatacacatggtcataat
tatgactttggctgttttatttatggtataggaaatgacggaaaagataagttccgtgat
agatggtttaaagaaggagtcattttctattga

DBGET integrated database retrieval system