KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy1402Help
Entry
MGAS10270_Spy1402 CDS       T00355                                 

Definition
(GenBank) Glutaredoxin-like protein
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin Thioredoxin_2 Glutaredoxin TraF Thioredoxin_3 DUF836 Thioredoxin_8 AhpC-TSA Thioredoxin_7
Motif
Other DBs
NCBI-ProteinID: ABF34467
UniProt: Q1JFU2
Position
complement(1337883..1338323)
Genome map
AA seq 146 aa AA seqDB search
MEHRLSMHYFQVKKEIFGVLLLSPVILLIMWGYVSSNQDDGRLTQKQYYETVVNQTVNLV
FYKKSCPYCKVAKKEIATQAKDSQVITYYVDTSTGEGQKLVKKYHVKYAPTIVSIRKGNI
QSFLYARDRGNNIIVEKEKIKEVFSQ
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggagcatcgattgagtatgcactattttcaagtgaaaaaagaaatttttggggtatta
ttattgagtcccgttattttattgattatgtggggctatgtttctagcaatcaagatgat
ggtcgactaacgcaaaagcaatactatgaaacagtggtcaaccaaacggttaatttagtg
ttttataaaaagtcatgtccctattgcaaagtagctaaaaaagaaattgctactcaagct
aaggatagtcaagttattacttattatgttgatactagtacgggagaaggacaaaaattg
gttaaaaaataccatgttaagtacgcacctacaatagtatcaattagaaaaggaaatatt
caatcatttttgtatgctcgagatagaggcaacaacattatagtagaaaaagaaaagata
aaagaagtatttagtcagtaa

DBGET integrated database retrieval system