KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy1403Help
Entry
MGAS10270_Spy1403 CDS       T00355                                 

Definition
(GenBank) Transcriptional regulator, Cro/CI family
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 HTH_26 HTH_31 HTH_19
Motif
Other DBs
NCBI-ProteinID: ABF34468
UniProt: Q1JFU1
Position
complement(1338481..1338915)
Genome map
AA seq 144 aa AA seqDB search
MIDVSKKLKQLRIDRGIAKSRLITYLSITLRTYDRYEDGSRTPDLVTLMKLSDFYQCSLD
ELVKGNTNDTLVDRALIVSYRDLKDKGLNDKLAHGLVKQVYDTYEFEKIPQISDANRIKF
IYKEDLVTLLESIVSKIQEEKKCD
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgattgatgtatcaaaaaaactaaaacaactaagaattgatagagggattgctaaatcg
cggttgatcacttatttatcgataactttaagaacttatgacagatatgaagatggtagt
cgtactcctgatttagtaacgttaatgaaattatcggatttttatcaatgctcgcttgat
gaattagttaaagggaacacaaatgatacgcttgttgatagggcattgattgtttcgtat
agagatcttaaagataagggtttaaatgataaattggctcatggtctagtgaagcaggtc
tatgatacttatgaatttgagaagattcctcaaatatctgatgctaatagaattaagttt
atctataaagaagatttggttactttacttgaaagtatcgtgtcaaaaatacaagaggag
aagaaatgtgactag

DBGET integrated database retrieval system